SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_08265T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AMSG_08265T0
Domain Number - Region: 22-54
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.00105
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_08265T0
Sequence length 247
Comment | AMSG_08265 | Thecamonas trahens ATCC 50062 hypothetical protein (248 aa)
Sequence
MTAASAAGYAERVLAVLGVAYSRVLLARFNGSRGHGSDDAESDVDVYIVYAPSTEEVLVA
GLEASVAPPDTLTTSIEAGAGPGIEKTTDVALYEVGKFLALLRAGSPLAVETVFAPSEDV
YVDPLLAPVLEMRDEVLTRKAFRSLLGHTSSEFKQIELAEARGVGWSKLLYHAQRLMLEV
EAVYSGGRPQVKFSGETLAALMATKQGKLGGAGEAALLEKLRSRHQQLQRDDPTPAHLPQ
ALPVNNS
Download sequence
Identical sequences A0A0L0DI75
XP_013755595.1.50528 AMSG_08265T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]