SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_08675T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_08675T0
Domain Number 1 Region: 390-604
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-55
Family DBL homology domain (DH-domain) 0.0000955
Further Details:      
 
Domain Number 2 Region: 1750-1829
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000119
Family RecA protein-like (ATPase-domain) 0.052
Further Details:      
 
Domain Number 3 Region: 1599-1656
Classification Level Classification E-value
Superfamily HAD-like 0.0000441
Family Predicted hydrolases Cof 0.045
Further Details:      
 
Weak hits

Sequence:  AMSG_08675T0
Domain Number - Region: 1332-1409
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.000118
Family Poly(A) polymerase, PAP, N-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_08675T0
Sequence length 2169
Comment | AMSG_08675 | Thecamonas trahens ATCC 50062 hypothetical protein (2170 aa)
Sequence
MEKDNACPGCGEEVEEDDLTALRVLGARFHREHFVCASCGETLAGRRFYEVGANKRTSVS
VGPLALTSSAMCCSCYEAANDIPHCQCGCNEPLLGTYVKALGFSFLPDHFRCTHPQCSTS
LVAGYMEANGRPVCENHWRANRRSLAGAPSPSSTASSTSSPTSSTRPGSDSGLASQLPSS
RVDSLRESGGTPRSRSIGSAPSGGVPPRATPFASLPFAAEIDAVTAALRPVLAAIKVRNP
GEVAPNLRSLVTSVKTLMASLRAMCINGDALASALKTASTKAVSQAKIVIRPAADDACWR
AFSLDVLELGKEVRAARDSAVLTSGAGAGPARPVARNASDLPSRTHKAMLTAQTGAANAA
RRSRALAAAPKRGPLPKNFREYAEYHSLDISGFTKNQLACQEVIYEMIQTEEAYVLDLLI
LIDEFLTPLRELDIVSADDLDALFGNVEEILPLHREMWLQFKKRQKERKWVERVGDILSD
KLRRILVVYTPYSSNHERALNTLESLTASSKKFRAFLQARFEDPKTKSLPLGSFLIKPIQ
RLCKYPLLLRELLRKMDAANDVDYAALVETADNLGTVVSRINEWKRTADNLNKLDVFFKG
LEDPDGLLPPDLKIRNFITEGELNIGVIVPSAIKRNTMANSILKPRTEYAYLFAGLLVIV
SRKRIRSTRVVTAAHDLDAMHLLDTPPLISDTFPHSIALTPLISTATASSVDTASVRRSR
SSATPGDLVVLVFDSPHDRTPWLKAITTTMTERNESNPSPRLVAALAAAESLADETAEAT
TKAMAGMARSGRMGEELRGDLAFLATVAVARQPMAVIDALDTAARHAAGVGELRAQLAES
ALLVSAIGCESGTAHVAYSNAAAFHGSWLAHVRGHKVRVGHEHGGGEGGGGSGSGRGRAD
DLLVDPVATAAAGIPALSHSPEHSNPATSVLSFPLLKFFDLRPGLVSLSALVAVLGGAGV
AMSEKLDGAIIKLTPRAADNSGLLIESQKTTLRHGHPMHRMLCEAVDLPALAARLEPGVT
YVIELRHPELTTTVAADKPSAYLIAAVAHPPAYRMLNVATVASSIGLPIPRRLPLPPAAE
VDDVVAAIEAESEPGFEGGVLAVESAAGEPLLLIKVKTAMWCALHDLGLASHDALLADLL
VSQLHALAGDVGVAVRGLSPDLLAHGVARHLGPVLPARLGAAVANLGRALDRVDAAALIC
LDDSALHAHVARLDGMPPVVVTTIVKWARSMSAASGSAAPLPPLSRVFAREALAAGGIKH
VLSLARAVLSIPSGLRTPSIAYPARCGRVLPQLTRAQAMSMYLVCREMTSAAADALVADV
AFAGPDSGQLACYRRLQAWASSTLPPVALRPFGSFAVLGGALPVGSDIDLLTNTPLDELA
PAIAAAFGDDLLQSRIVTDAAFPVLALEFAGGLLVDIVYDGSAWTIMDANTAVRAALIAA
GSEADTVSRRTALVAFTRHMRRPGLLPSSMHAHMLFLGCCARIGLVPRADPTQTRVVHQW
VGDVVAPFYEHAPPVLSSVTADGASASVSGPDAAALVVAVAAEVCAVLETGGEVSVLATT
AMAAVGSGALGAGTNWASLAALRMQMTESVAAGAGEVVYVFDFDGTLFDETTAAASVAMP
ALLSRVVAAGAPVLVLTGRIQSELGPIYRILGKSGALRVPVFARRASRQSALNFKAEVLA
DLAAASVVDDSWQQIIHYDDIGKVLRVSGRMAAPCTVTPMLLVNCGKAPLRHFTPDLMAS
STAQDGSGTTVVRVIVPGEPGVGKTTFLTKLCPALQEALGEEAVVTVLANDEIQATVGRA
TVARELKRRANEAVDAARAAGKTPVLVYDNRGASSLIHDASWLVLRLASTPSGYEVMDAL
AYLGVLDRPDHASDASSVEAATVSREAWLEYTTAVRKLHSRIRDGKYKHGDKVVAATEAA
GGQVVSLGICDSAEAELALAEYAEPLATIKHLFSGRRKGNPMAGLSWGEQAAALASALDE
VRGLHSRIYDADGLLDVAVSAVVDGVTHGGSARVNAAVVPWFRFAGLSLPTLSRAMCTWR
ATASGDSAWARAVAAAGGDSAALEADADARARIGFHVTLRYIAEATVGDVRALDETANAA
LADGVEVNAVELVAGRGIVCLAVALGGIEVDAGRRPHVTLATAPGVAARVSNDVLDALHR
ARRSRRGCA
Download sequence
Identical sequences A0A0L0DL75
AMSG_08675T0 XP_013755096.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]