SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_08738T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_08738T0
Domain Number 1 Region: 196-406
Classification Level Classification E-value
Superfamily RNI-like 0.000000000196
Family Cyclin A/CDK2-associated p19, Skp2 0.087
Further Details:      
 
Domain Number 2 Region: 17-66
Classification Level Classification E-value
Superfamily F-box domain 0.00000209
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_08738T0
Sequence length 419
Comment | AMSG_08738 | Thecamonas trahens ATCC 50062 hypothetical protein (420 aa)
Sequence
MAASRVAGGVAPVPRAERPPGASLLALPAEVLVVVMDALPLQSVLALRATSRRLHEVVPL
ASRWWRGPALVLAPAAGAASPASVAAVLANRLPARHLDVLRLAPAKQVALGHALDDVGVV
LGRLRKLAVCEPAAAAWAAAQGSVLDLHVAQLAMKAERRWGDELLSDATHSLVVSSGLAR
ATMYGYPRLDDLVVAAGSLVRLDLSGVILGVGLASDLCPSFTVLKSLTLNIVRLTELVGL
VVPRTPALSVLRVAGKLVASHKDDDMALILAWVAAEDAKSGGQGLRQLEVNSSKHVSWSA
VRALMIGMPQLRVVGMRDVHSTMDGNARCIEVADNSELASLDLSFNKLLQHWRQNVVLEG
LVRLDVSYCSLPRVALIMVLEATPALEALEARGEFAVSDSLVDDLSDVWQSSRLRFRKL
Download sequence
Identical sequences A0A0L0DLX1
XP_013754514.1.50528 AMSG_08738T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]