SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_08791T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_08791T0
Domain Number 1 Region: 290-363
Classification Level Classification E-value
Superfamily SIS domain 0.00000311
Family mono-SIS domain 0.0038
Further Details:      
 
Weak hits

Sequence:  AMSG_08791T0
Domain Number - Region: 66-168
Classification Level Classification E-value
Superfamily SIS domain 0.0145
Family mono-SIS domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_08791T0
Sequence length 732
Comment | AMSG_08791 | Thecamonas trahens ATCC 50062 glucokinase regulatory protein (733 aa)
Sequence
MTTPARVTEQAHALTTKLSQATTPHAIRLLAAADAGVYAGSTPYPGLVDPPLLEAAAAAA
ALLAPALRSAAADETLVVLGGCGTSGRLAFLTATAYNAVAPAPRFAYTLAGGDVALVLSR
ELPEDDPHLGADDLAAAIASAPSPPAHVVYVGISCGLSAPYVAGQIEYMLHHYAADPASG
AILIGFNPAELARDAPIEGWPHTFASLLNGRFADAAAAAPASWILLNPVIGPEPVAGSSR
MKGGSATKVLLDTVLAGAATIAAGAKAASPGLLLKCFNSLDNASVAAYGAGPALVDLVDA
AAAAVRGGGHIYYVGGGDAATLGVIDVSEMVDTYGAPPDQIRAFVARGWAALRNAEGDMI
AAHPDSPLLDISLDAFVALVVPSLTANDLVVGLMPTAAESAADGGNAAAAVMAALRGALE
LPSPAATPVLGLVAIGEPGLVGDARYEWDSLVGLATAAVTVNLRGPSPYTLPGEATTLAV
EARAHLALKIILNTVTTLAKVAEGVVFGNRMINMGINNNKLYYRAIDMIATLMAVPTQRA
HACLLGAIYGAPGLAEAAAAGVDDEGAERVRHHIEIATPRANVLPRALLLAGLGDDALDT
LDDLLASEPSVARVLEAHGLWWHAILYWTLDAAYALYADASPRPVMTRVAFLNDIIDALA
ATPTPSVPRRRTSGSVPLQRLLVITTFPCEPLCDATASPAGSFMISDRGRGPFAPRAAFI
SASPTVFCCGSQ
Download sequence
Identical sequences A0A0L0DLV3
XP_013754560.1.50528 AMSG_08791T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]