SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_08833T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_08833T0
Domain Number 1 Region: 115-229
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.00000000000129
Family Toll/Interleukin receptor TIR domain 0.013
Further Details:      
 
Domain Number 2 Region: 7-77
Classification Level Classification E-value
Superfamily RNI-like 0.000000113
Family 28-residue LRR 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_08833T0
Sequence length 313
Comment | AMSG_08833 | Thecamonas trahens ATCC 50062 hypothetical protein (314 aa)
Sequence
MSDNDTLVALVHRCPHLKCIDLTESGEDITDSALMVVAVDCHGLEVLVLNNSSAITDDGL
LAVVRNCRHLRTVLIKYQSAGSSPTSSPPPTSSQTNEESASGGYMASPSFIQPPATNISG
RKWDVFICHGGGDKGIARDLYNNLTGRDLRVFLDIKSLDGERCATPRDMVAHVKASSVVL
VLVSKFLIVSRWAMAEAKAAVDAADANRGKVFSAIIGSDITSTTLRNMKEHDVNSIDHPL
IHAMDNFFQTDAHHDQWSNWRHEKFTPAHKTDHVATVFRLLEYGFAPFGPSDQPSEIVSE
IAKRTRILATGSP
Download sequence
Identical sequences A0A0L0DLY9
AMSG_08833T0 XP_013754589.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]