SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_08837T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_08837T0
Domain Number 1 Region: 9-155
Classification Level Classification E-value
Superfamily RNI-like 2.94e-37
Family Cyclin A/CDK2-associated p19, Skp2 0.0059
Further Details:      
 
Domain Number 2 Region: 204-372,409-495
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000996
Family Ankyrin repeat 0.0028
Further Details:      
 
Weak hits

Sequence:  AMSG_08837T0
Domain Number - Region: 552-632
Classification Level Classification E-value
Superfamily Tropomyosin 0.0144
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_08837T0
Sequence length 642
Comment | AMSG_08837 | Thecamonas trahens ATCC 50062 F-box/LRR-repeat protein 2 (643 aa)
Sequence
MAMVVAEMCPNLTTLDLFSCSNITDAAVVALAGGCPNLTSLRLDYCSNITDAAVVAVAGG
CPNLTFLDLYNCSNIILCGSVVALAGGCPNLTFLGFGNCSNITDAAVVTLAGGCPNLTIL
LLGNCFNITDAAVVALAGGCPNLTTVRLDNCSKVTLDLGRARTTIAQPDFPASQHAHALL
DVAQAHVPHPVHAIDRCNLLSLGALNTLLANGADLYDLDDDNKHAYVHSPASSAPVFVDL
MIESLQANADGATKLANGINKATLALFVALRASPTVPISADIVSELVTAGADVNAVEPTF
NTPVIHVAAANTEHGALKALLEAVAALDVVLDQSAVDGNGATVLDTIIAANQLTAEAMAE
LGGVGLDPFTLQPDNTHVYVAAPVERSPAFSSAMVAWIREHGDGATELTSGINKATLALF
IVLHAADTIPFSIPVFTFLINSGADINALEPSLELRPLHIAVSPSNILATMALLAAGADV
WALGTNGETAMSIASAVLNKPGSDTNAAAKEVYNLIVGTSSIPERVADHVRETIAAGGDI
GGGAGASAGSSTRVDKLEAELADTKAELADTKVELADTRTELADTKAELADTKAELADTK
AELADVRDHVTIATGNIAALQADRANILQHVDKAITIFQARR
Download sequence
Identical sequences A0A0L0DPI8
XP_013754593.1.50528 AMSG_08837T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]