SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_08869T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_08869T0
Domain Number 1 Region: 153-282,363-530,593-641
Classification Level Classification E-value
Superfamily RNI-like 2.67e-26
Family 28-residue LRR 0.012
Further Details:      
 
Weak hits

Sequence:  AMSG_08869T0
Domain Number - Region: 96-149
Classification Level Classification E-value
Superfamily F-box domain 0.000327
Family F-box domain 0.019
Further Details:      
 
Domain Number - Region: 787-834
Classification Level Classification E-value
Superfamily RNI-like 0.022
Family 28-residue LRR 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_08869T0
Sequence length 850
Comment | AMSG_08869 | Thecamonas trahens ATCC 50062 hypothetical protein (851 aa)
Sequence
MPSLAHAMSLVNPTAPTPSATTTTAASAARGVSAVGPFLRLAVSSAQTAAAKAALPPDSA
RLLAAAAANGSAPATRAGSAHQLINLLHAAPAAAAAVLHRLSVSDLYALRATSKSARRLV
DAARSWAHLPPELWPLRELSHSALIGWASSGPLALVTALDLSSCHAASEEMLLALARSTR
ALTRLILVATRGVTDAAVAALTAANTGLIAIRISRARALTDEGVMALVDAARDLERLELS
YCPKLTDVSAKVVGGILAKLSWLVLDGLRKVSPEGVAALANAGQKYAHLSLTGLRGVDAP
SLARLAPALAPAGHLCLASCPRLSAAGLRALALSPSFTPGTLVLRATGRDCSDAAAGLLH
TSPQTAFASLATLDLSSCAGLDSAVIAHLATGTFPALTRLALEGHPRLGDANLSQLLLAA
PALTSIALTGCRMLGDTSLSVLGSRGPGLVHLALAGAELATPAGFAALASGRALARCTLL
DLANCCGLRGDGLRALAAAAPQLTELNVSGNTEVLAADVLAVLAALGPHMLRKLDASYTH
APAALEQPAVELDPQFVPSALPRMTELSFAGWPVVDAELLTAFARGPLPSAARSLTHLNL
EACTQVDDESVRLVASALPHLSVVNFNWCTRVTDAGVVALVALTGPRPGRDGGSGGDDGD
ELGESDPFADDALSGFVGLSSFASAHHVASTSSATGIPAASPQPLASIAPTRSRSRSKSR
SSAKPPAAGGQLPTSNGKKKHKKKRKTHQKSALGNRLVSVDSLVDDSGDGGDGGGGDKVS
LPSVSSSLLSRIGLYGLHQLTDAALDALGLCRSLEQANIGSCPRLSEGGQQRLLHALPRV
VLVYAEPRNP
Download sequence
Identical sequences A0A0L0DMV3
XP_013754412.1.50528 AMSG_08869T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]