SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_08873T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_08873T0
Domain Number 1 Region: 10-143,202-332
Classification Level Classification E-value
Superfamily RNI-like 7.07e-42
Family 28-residue LRR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_08873T0
Sequence length 455
Comment | AMSG_08873 | Thecamonas trahens ATCC 50062 NOD3 protein (456 aa)
Sequence
MDLLGATVEEVMLANSAMYDDGLTALAHELTLESSQVTHVDVSSNAITTAGVEELALALH
VNTSLTSLSLRNNELSDTAGDVLASLLASARTLASLDIGFNELGDAAMHGVARGVAAARS
LAKLSLAANGISAIGLAYLVDALNGSLLAAAGQASTARLAKSPSATKLLSDEASAAADAG
DGLSQPSVYLEFAMATMTSVDVARGMTLTALDLYWNQVGDIGATLLASVLSGSEAGLTAL
NLGYNSIGDDGAAALGKALASNATLLELNLKSNTIADDGASAFAAGLAANKRLMRLHLDA
NAITATGARDLAAGLHANVNVNMITLSGNPCEACEEVMIAVSEGLANTSGAHPESSSADA
GVVSTGLLTNAAALRMATETATEAAPSRLHNPLGIRLEPSSRFIRRTPLFCIDQTSAAHA
IKRHRAERKSKHRRQRREREARRALEAVAGSEHSF
Download sequence
Identical sequences A0A0L0DM21
XP_013754414.1.50528 AMSG_08873T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]