SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_08896T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_08896T0
Domain Number 1 Region: 234-388
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000589
Family Cyclin A/CDK2-associated p19, Skp2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_08896T0
Sequence length 565
Comment | AMSG_08896 | Thecamonas trahens ATCC 50062 hypothetical protein (566 aa)
Sequence
MPDDNGDAAGVGAGAGSGAGAGSGAGAGAVAGERTEAAGPTDGAAVEAEGSPGGQPAWVA
TARKFEFSVARPVTTAASFGVWASSPQTKAPLADFLTRRVPMKAPELGPSAALAVEEVEG
GKGKGKETDEADGGTIGLGRNISLQSVRAVHHPSDSKSLFAPDKQPARRRTLAQVPSLTD
IVLGVLGDRLASGSLSAREAVAAGLPPKLLAMLFTFLQKNGALSWEAMRLFLNPEVLHLD
LSALVVSPKMVDIMAEQCPHVWRLTLRATRFSDGTRLLAPIQSSGTLGVRLATHFPHVTN
LQVTDFVSLSHKDLFAMLDRLGAGLVHLDVRNCVALAEPDDTAWPAMPNLVTLDISHTCM
TTKSLKSLLTAAPQLERLDAHHVRFISHWSHEGAPLTAVFASLPASTTELDVSWPRKYRN
EKGLMTMTTAPVLNHVLDTAALHALAAVAPQLVSLNLTAVTICETDGRSCDVDATLAAFT
ALRKAKDLRMLRMSSMIHRPRGRAAGVVELALGIPRVATEATGQGDTAAPEQDYTDIDPA
LGAYIAVERAGRGVGGAAAGDRAAR
Download sequence
Identical sequences A0A0L0DMY2
XP_013754434.1.50528 AMSG_08896T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]