SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_08966T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AMSG_08966T0
Domain Number - Region: 94-184
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0105
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number - Region: 219-281
Classification Level Classification E-value
Superfamily PH domain-like 0.0479
Family Third domain of FERM 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_08966T0
Sequence length 518
Comment | AMSG_08966 | Thecamonas trahens ATCC 50062 hypothetical protein (519 aa)
Sequence
MSTCGELVDALLSSADLFSWLHTPLTTSTEDKPSPVPEDWRHSFVLTEVVGDITRYLPPH
SLLAPIIARWPALIGAPSLRLNVLHFNAVRAAAADHPAVLALLTADAAEQIRAGILHLDV
PTAAKLAGLVLAVTWGGAASKAQLRALDAGRLSDVLPRSMVSVHMPGVWRALLLDEASKW
DGLDTVGVAQVLLSEMALVPGANTLWLAPCSCLQVADSQVRIGVAEEGVRVLNVPSGSLL
LAFAHSKIKRWAVGQGSLALEIHHLSDVYQFVIHTPQASLLDAALLMCVREGLHKRSLHA
ARTMAMAKRSSDPSATLFTSPGPGGDGTRPGPPVLPAAPSPPPSLPSAPSSRPSSRPSSP
RTRKRVVKKKRTSARSRTPPARGRGRGRGRGRGRGKARGRSRTRGTARTRGSARGTTRRV
VKRRPASSRPTSSASASRPASPTGRPKSATAKSRPTRLVTKRKVVAKRGTRGKTKASRAR
SRSASPAVAGETKTKTKTKTKTKTKRVVVRKKRVRKRG
Download sequence
Identical sequences A0A0L0DKR4
XP_013754931.1.50528 AMSG_08966T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]