SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_08977T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_08977T0
Domain Number 1 Region: 50-171
Classification Level Classification E-value
Superfamily RNI-like 2.88e-21
Family 28-residue LRR 0.021
Further Details:      
 
Weak hits

Sequence:  AMSG_08977T0
Domain Number - Region: 484-494,563-573
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000445
Family Formin homology 2 domain (FH2 domain) 0.043
Further Details:      
 
Domain Number - Region: 237-295
Classification Level Classification E-value
Superfamily Gam-like 0.051
Family Gam-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_08977T0
Sequence length 658
Comment | AMSG_08977 | Thecamonas trahens ATCC 50062 hypothetical protein (659 aa)
Sequence
MLSKKQGNGVWDLSALDRRLDEQDVSVLTRHLLRPSLAASLTVFKAANVLSIVHTEAILR
SLRSCSALAHIDLSHNPLGPSLLAILLSSPAPSVVAPLPSLRVLELAACDLGDRGALVLA
AFLSRHPVLARLDAAGNAIDDQGAFELASALDANDSLVHLDVSGNVFGEAARAALEASAS
AVCSVDVSRSLSELSASGFRPGLSLVDLSASATSTAAGYQAAVDAQGTKEQVQKYLKRKE
AEWAARAEAERRAALDALAADYDARIAAINATHSEALAAQTRSFALAQHEVVAAATAPLL
ARIAELEAAMSVRQPASPSFRELSSITQTPLEVTVLTASPHRSPRQASLDPNPLWETEPD
LNSMCAPFSPSPSPSAKPSAAPPPPARPQTVIPASAPGLRDWVVFDESIMASSARVSDVA
PAPPAPLARSLLPPPPPPLAALAPPPPPPPPLTVAAPAAASGSVTIPHPPSPPPAPVATS
FAAPPPPPPPPPPPSLSSEPPSSTPRHSGAGTNALLDAIRTTNRSTLLRKATERPDGECN
RIARSNRPQSTPMEQALGTSLKNMWTKLASVQDNAENAAASPLDKSAWSSSADDGSFELN
LRSRKSHGGGGSRPSTPLRERVNGAQAPADALRQHLFTIRRANMTVDGDESGIDDSWM
Download sequence
Identical sequences A0A0L0DKS5
XP_013754940.1.50528 AMSG_08977T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]