SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_09168T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_09168T0
Domain Number 1 Region: 120-236,476-601
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000824
Family Cyclin A/CDK2-associated p19, Skp2 0.078
Further Details:      
 
Domain Number 2 Region: 1-48
Classification Level Classification E-value
Superfamily F-box domain 0.00000000392
Family F-box domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_09168T0
Sequence length 623
Comment | AMSG_09168 | Thecamonas trahens ATCC 50062 hypothetical protein (624 aa)
Sequence
MDSLPPELVHHILKFVPLPTLGAAAAVCSTWATLATSPAQLAVLDTSRLRHVLQEQLLAL
IGRAGHNLAALRFVLYSPQASGSYLKLHGLADLLAAHHAGTAVDRPRLPKLEMLGGALPA
DVLPLLAKHAPRLRVLALRSWRDAELANVVASSGQLLARLTVLHLAHVPVSDATLMALAD
ALDGGPLEELAIDGTFGDAALSQLLACLPRLGTLALNKTSRLSELGLGEALAGASGHLTA
LFCNQAALKAPQWEAASLDEPPPVALSVLGQLFEHKSEPRHPFPPPFARMYSPGPLFTAL
LWPSLTHIACDSMVLSPQIAATDLALAALLFSSWKTIEEIVVWGAPVSIAALAAVLSDAL
ASEPASRSPPLADLVLPASVAAVDELAALLSVPGLALRKLQLAELAQGGDAECPVPANLS
DLAIARYTHTGEDAVLAALLASCSLERAKFGRLASPVSAARVLACLNGCPSQALKLVELH
LTGPSPDDLELTCLGQVQDAQLSWQSGSALQLVARMPQLRFLSLSGVLGSLPELLSCTPY
LASLLLESSEWEMGEAASNVCLSELHTLQLKKTRSPGSEAELDAMLALFPRLRRLRLSRT
PIDGASTSAVGGGINLLYAHQRA
Download sequence
Identical sequences A0A0L0DKZ9
AMSG_09168T0 XP_013754879.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]