SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_09190T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_09190T0
Domain Number 1 Region: 1907-2189
Classification Level Classification E-value
Superfamily RNI-like 2.62e-41
Family 28-residue LRR 0.036
Further Details:      
 
Domain Number 2 Region: 1765-1858
Classification Level Classification E-value
Superfamily RNI-like 0.000000228
Family Cyclin A/CDK2-associated p19, Skp2 0.017
Further Details:      
 
Weak hits

Sequence:  AMSG_09190T0
Domain Number - Region: 1041-1104
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000463
Family DEP domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_09190T0
Sequence length 2269
Comment | AMSG_09190 | Thecamonas trahens ATCC 50062 hypothetical protein (2270 aa)
Sequence
MSSKVYARPGEAKRRVTTSLRLVYEVCDLVSAFLARLSSPSASASSSPALVDHARGGGTP
SQLAPATAFDVLGILMTLVDIAVSLTVSMFTCDVQSEYFAHAPASALEAMPVANPALLLA
RVGRQVAGKLAAAGQVRDAESLFKTMLRAAESFPDPQAMFIHVLSAAMEVGDMLLVPGAM
LDPDGARTLYALVERALDDCPGMVVPPRVAEKLMASLAHIELLSYTVAPPACRAGAPLSS
CARRRSSFRGQRRARPSYVASAVRYAQAVEQQAEGDAAAAYTKQLALLSNELEYVFHYTP
AYDITSYEGRLHRLSAGLDYQPLADLVDDLLARAALVMAARHYEQAAQLYALAWKAALAA
CDRYNDSDLASGSTATYGAVCVLRASSVPGHRWTTLEVMEGYNAALRLVLDPPSLDTPPP
LPRICAAPMPWEVHKAELARSRAAAADAYADIDAGELGMALSSAQLVTSTLGIMEQVTSD
RVQLFTRLVDETAALMGPPPFNIGYAMLSLGSMSAAAMCHYSDVEFAMLVEPLSSNADFA
ATVASHVSQSYSAIRARVSDCLAAEAESVLAEPAAFPQYVGMTVADVVDALRPLRSGELA
AKARSSLVAERMAAAEPAAATKVRDYFESFVALLELKIVALGETSPDPLNPRWKRGFCFD
DGGNTPLAKDPPLLGTPAELAAQLRPRSEFVDDLILVGTLPDAGYLCGCPKRGPQLFAQF
QTALAEVLDAPHPMLTGTVRQVYGLTLIRESVNASFQPRHFGTSPDATLNVKSSMYRMTS
LWLLGLSLFYGVPRRSAPEPYMTFPQRIAGLVSRGHLSACVGRSSSKVLAFAGLIRATVQ
AAAGTEADSVMASWPHYMPPSECTASANTARVADREAARAAAARATLEIVPGVLARLAAS
DSGHEASPRGTGTRGAGIYRLSCCQTHGYHSLFQGYLIPLAGTIVEYIGRAESLGFGAVR
TDDEALSGQLTRQHIAFVDTSRLVAGITKRSLANVSIPSFIMTQLSTIRGSVYALICHTP
FLAFSDAPTAQVPPPPPPQVPGLFVGSEAALWIDTHMPGQQTEVVSFAQALLDAGIIRHC
CHSCTKPCSAPFDSGFELYTFPPQDELDAAMERIASAHAAHAAQSAYSSVTRGKVYAEDP
TLLAIRDWSTAGQHMPADLMTVAYQSDSVWPLLESRLELELEQLQQWQAALVALASTEPD
DSHLQRHLLYLEAGLANLQVMYAEVLAKLARASSPEAKAEVVAKGVLAHGVLSGHRLFTP
SVVAPVLAAMDSHRDSRDSAPVATPVFQANVAGNAAGSEAEAAHDSDERAKSGGQLSTST
PQQHIVCKRHAPALFGGGSGAGLFELLAFRRDASQAYNCRLMETSSVVQLVGVGHEARPL
REALAECAGPLTNAGWRKSAYTEQLFMHLLLEPSVVEPENYMACASTRDRNTQLVVGTDF
SGWFGACPRIPLHGRGRSRSGFALRGSESHGSVNGGKGGSSDGSGAGTAATERLALDAVS
RIQRRLAELTFSCMDELQSPIDAEAQEDFMRRRPEQVLSAWLEGMIRQNIAYRETFTLPQ
LQSLYDGGDGILVPFVLSEAVVAQVYERYLWLQRELRQNTSGTLTHAQLLAKRFPELGQV
YASVTEVSEMDALQRYEIVAKHYTHVLASDGMVLDEGQRAFLRRRGIDASAHPKMYVSTV
GGCEADLGAYFAKHCTPEYGLSVLYSAYEVEEQVALAIEGMCSGSPEVFEQLDLRLQEQA
VRRVPWREVKPSKLGSVLQCVTLLAPRLESLYLRRARGLDDAALETIARGCARLRLLDVS
WSQGAVAPGAVLASMGALEHAVLAHVQSLQSLAGLERSGSLVSLDLRGCPSLHTLHLPSY
PMDINACRFTYHGLSAVVVGDHAWHPIVFRAAVELRMHSVAEVELVALAGEAARAGSVTQ
LCIRNSTLCSQGSDAMAALLVNSPLLERVDMLGVGLGRKCVTKLADAIERGCPRITTLVL
GGNVLAAKGASQLGRALEKHNVIEFLDVSRAKVGSSGTKLLLEPLVRAGNASLTHLDLSG
NPLGNTGAGVVGRALENNALPVRMLRMAKTGMQNKGLVALASGLRHNSLVTRLSLCGNRI
SGAEGVRALMEAIGAGHSAMARLSLSRNKVDDAGAVVIASELHNAGALCVLELERAQVGV
LGAGALARALESAPRLQRLRLANNAFTIKEVRGRGMFASDMSVRQPCEVVLASDEVVRIG
LALDAGSTFVSDESSEWHSSSTLGASDDDMSSEGDSTGVFTSLDSDSWE
Download sequence
Identical sequences A0A0L0DL69
AMSG_09190T0 XP_013754896.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]