SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_09267T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_09267T0
Domain Number 1 Region: 473-568,617-691
Classification Level Classification E-value
Superfamily RNI-like 0.0000759
Family 28-residue LRR 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_09267T0
Sequence length 804
Comment | AMSG_09267 | Thecamonas trahens ATCC 50062 hypothetical protein (805 aa)
Sequence
MGNKTLFQLLIFLRHPYAISTETVASVALPPLTYSANGYRAVTRLGGRSVSWWAVDAVLT
AHAPVIVYAAYLYSDDFVVLDELHLPLLHADAPACYAYDALALVPSPACSSPNALRTAAV
AAAPPHASPLAWETIHADDGSWRLVCACPNHGAGWYRVRSGHTDDVVVSIAPPALALLSL
DPDESVPDDVHLHAYALMATGLVARVELVYRNTPVVVSVPHLAPDGALRVVLHNASTWRN
LANAEAALPYARLSAKLALEIPLFNLPLRSHDFVDWCHRPKRPACLPSLAHLAAAAAVPN
LASFPDAQLAAAPLEVRAVLLDHAVQFMAELGAAFGPLVLSPRALLAVLVSLAPPNQFSL
AYWAWLPAAIPRAQILHTYLFDVLGIGMPNRPASLKVLSLAGGEPVVPRDDSAIAAGDAA
WAYPLGESSELADVMPSGVSPFSGASSCALSLDDVVSQAMAVSDLCSPLATLGLVSLDLS
HCTDVSGATLAAVVGEVVCGGVLRSLAIAGCVHLSLDELAALLDAASTAELTSLDVSALS
PELQATACTTVCRSMTSLQQLALREYTALPPGAAADLGAAFDTVSGFDLNISGSSSLNLL
DLGSPVPWGVVRASGTAPIDLADLLDVLSAATVISVSVSGCARALSAPRPAPLTDLDLCS
CYHELMSEMEGEVMLDALIPLLTSSLLSLHLPSWAPVDDAFLAALSESATSLAAGAAVAE
WMDRAHALASVCLHGLKGDDQGGALAEVLDAVRGFDADRASVGRALESVVLRVGSADDVV
LPPDALGGTEVDGLDAVRCVVIRV
Download sequence
Identical sequences A0A0L0DME3
AMSG_09267T0 XP_013754658.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]