SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_09421T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_09421T0
Domain Number 1 Region: 51-262
Classification Level Classification E-value
Superfamily RNI-like 4.42e-41
Family 28-residue LRR 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_09421T0
Sequence length 269
Comment | AMSG_09421 | Thecamonas trahens ATCC 50062 NOD3 protein (270 aa)
Sequence
MGGKPSKQHVVEDVVAREAEDIARKEAMLRGMVSEDGTSMVVRDIPADVCTRDGIEALRR
VLADGLALEKVVIEGCNIGVVGARMIARLLLDVGWIELSLARNHLGVEGTTVLAEVLKGN
SVLEVLSLAGNSVGLAGASALASLLESNRSLRVLDLGETDLREEGMAVLAPVLAQNRSIE
SLDLSKNDIGNDAGVHAVADIILGNTTLTSMSLASNSIKRTGCLVLLEALRQNHSLTSVD
MAGNAKTDGGAELLADHLKVNATLGDSLF
Download sequence
Identical sequences A0A0L0DM68
AMSG_09421T0 XP_013754783.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]