SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_09494T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_09494T0
Domain Number 1 Region: 610-732
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000068
Family Second domain of FERM 0.0016
Further Details:      
 
Domain Number 2 Region: 241-357
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000222
Family Second domain of FERM 0.0045
Further Details:      
 
Domain Number 3 Region: 533-612
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000482
Family First domain of FERM 0.027
Further Details:      
 
Weak hits

Sequence:  AMSG_09494T0
Domain Number - Region: 731-845
Classification Level Classification E-value
Superfamily PH domain-like 0.000133
Family Third domain of FERM 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_09494T0
Sequence length 854
Comment | AMSG_09494 | Thecamonas trahens ATCC 50062 hypothetical protein (855 aa)
Sequence
MSHDENALASQPLGNSLQLVHSQQTTSMPTTGASSATSFSAVAMAAAAFHPGSAGRKGDV
LGQEHEEDLTPEERIQRRLDERQRMAMTRHLDELERRKAREAMPTQGAPRKWIMVHLVTP
DGSVQRRVQLHELVSGEFLLKGFAEKLKLIEWEHFQLAKVIGGGNAFARYLDAVEARLVM
PDAVDEASTSPTPRARKFAPDASSQGGDHATAIPQLKLQWIHDEVKVMEQGVKEGDVLVL
MVKLYTADVAECTCVRAVQLYYVDIAIKIFSHVWKVTAEQAYKLASFMVHIRLGSYSKAR
EKDRSALANSLGHILPASFIPRSKKARKAVTRTIFRYYKEYAGMRRTLAMINFCEYATLA
AGYGSIVFHVHQSSSAAAAVGSAAPSSADSGDELSDGDGAMGALVDARRRASAPVRSLAI
LPQGLAVYDAAAWDAASADTLPLPLEVHTFESDIDAFTYDAGTLDVVLSSGRILSFEAAK
VGADNDSLDGHDFAELSVEPMAHAREVLGGYQHFFFIGKVSTPGASHRRRTAFSVAVSLP
SGELRESIAVTQTTTGDKVFREYADRLQITHRAGFGLCESTLDNDRWLDMNRPLVDQFVT
KRTKLVFKMRYFFITDASIAAEDDDHAVMAIFHQVRQLILDGYYLVTEEEAIEFAAFSCF
VENGAYDRSAHAVSMIVADGLGTYIPTWLRPKRKDREWATMVFSRFRKMGDVGSDVEAQK
AYIIRAMDLTTFGITYFKVLSDDDRDLLLGVAPAGIVVFTATHFKKLHVFSYRDLRIDVT
PAAVTLTVLVKDGEVDPLLGAAPSHWEDHIMYTETPLEAKSIREMASTYHRIAYVRAQVR
ARERARALAVSGAF
Download sequence
Identical sequences A0A0L0DP26
AMSG_09494T0 XP_013754338.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]