SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_09718T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_09718T0
Domain Number 1 Region: 200-567
Classification Level Classification E-value
Superfamily RNI-like 1.65e-38
Family 28-residue LRR 0.053
Further Details:      
 
Domain Number 2 Region: 101-187
Classification Level Classification E-value
Superfamily L domain-like 0.00000408
Family Polygalacturonase inhibiting protein PGIP 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_09718T0
Sequence length 1381
Comment | AMSG_09718 | Thecamonas trahens ATCC 50062 Hcr2-0A (1382 aa)
Sequence
MRVREAQVSAMQAAALEEARAAGRRQARAAGVVGGEAGGSYELLQRFFYDFGGPEWALSY
GWLEGRDPCCIPGTSPCRAWYGLECAYDGPNATVGVVENVLFSDNNLNGKLQLIEDSLCQ
MPHLVTLAVLNENITGTLPQCLASMPALLQLYLSNLNLEPQPLPLFLASMKQLQVLALAA
VNLVGPIPDEAAALTGSVFSLILSDNTLTGTIPEWLSHAGNLTSLVLRCNALEGTIPPSL
FARKFALLDLSQNKLNGSIPDAFLPYQYYVSLDLSHNQLEGTLPPTIGYVASSYFPVNIT
LAGNMLSGGVDVLFPAYSKLARLNLASNRFYGTIPAAVGLASNLSELVLSDNKLFGTIPA
EIGNMGQLELLNLADNEFTAIDRSMTLYTIPKLRQVSLRGNRLTWLPPLVYLDVVVEDNK
VTQCAYTSLMTFLDVSGNPIRPLSGGRRLRMGDILSMLIASDIGVESALLSCVQGLQTGY
ARLKTLALAQIGLSGSLMPTIFEVFPGISHLDLQGNNLGGPLPQSTTFFSFTLPFSLEFL
DLSNNALSGSLPAVYGPALETNLQFLGLLDGNFVCPGLTAPHSRAQIHVDATYYHRTLCR
CSPRFWGKVQADGSGCHSLATYCDDEKECIVHAPSANETVSVASTAVVVSKGYWPSPSAD
AAVLLIRCTSLPVPADQIACNPAGRLECTPNIVRGENGETLSKFSCKPVDEVCRWGHSER
LCGKCETGFFRTAVGCRQCTGLISSPWTLVFGLIFFFIFMGLAILIRTRDPSPQMQRIRE
HFHEQRTLREFLTAYRGELIQVTSLYVSFCVAVAFVEPSWVETMLALFATTYYVVYSLLR
KSLPPDEGGSGRGDGRNERTALLARAHSDGQDDRDAVGGFLGETPVRDVREALAVASGVF
KSFVVYFQTLAAVTNGLVVWPKWGSFIVALNKLLVSVAPLVCQHPSLTYQDMFLIVMLLP
LGLVVAISVLFGVWVVYQWLCKIRMVASVKSSDDGAVRVAVAHKLFAVRVRTAGQVLFAV
VVLTGYIMFFPVMSTYFELYACSRDNTPLEQGKQQSISYMTTVPWIRCFNSHEYFSMYIP
GSLLMVVYVAGFVWVFHLLNAHHRGGELRHGAVRLQYSILFESFRRGAWWFEKVLTVRRA
LLALAVAGSATASLSSIGVTVVLTISLAIQGWYAPYSTSLGNLAEIVGLCSVIFSFLVTQ
SALRVYQASSASEYKLEGIPEVLNNVAVYNALATFAIYGLVAILPFLRLVPSIRARNWRI
FHILGLGRPEGKATPAVRAGATTGARWQSLMVSMADLPPSPQSSVQNANAAAQAELETLR
ARVAELERDARDRATAALRVSISFQAEMDQMRAKLAKLRATSGASAEELVCNGGGEDREA
S
Download sequence
Identical sequences A0A0L0DP52
AMSG_09718T0 XP_013754066.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]