SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_09846T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_09846T0
Domain Number 1 Region: 272-459
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.41e-34
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.0052
Further Details:      
 
Domain Number 2 Region: 104-268
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 8.5e-18
Family Poly(A) polymerase, PAP, N-terminal domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_09846T0
Sequence length 609
Comment | AMSG_09846 | Thecamonas trahens ATCC 50062 caffeine-induced death protein (610 aa)
Sequence
MVMVMAGDVRSAAVHFVKLHVGTPMILPLEPAEQPKKKKKKRNRRKKKKKDEDETEAEPE
PEPVMDERIRFLAPWPGVNVSDSEWVPMMDNGPQLVLPSGGWAANVEHEIRRKLQSKEPT
TKMRKVQTAALGVVVNILDGLMSRSYSGSCILASDESQHGASGPEPCVRLHVFGSSSNGL
ALGMADLDVALEVPQHLSGTRTKAGALLKKIRNQFMKRKHGLHDVLFIGGAKVPIVKASF
GHQPALDLDVSINNLLPVFNSQLLAEYMDDAPVARQLALAVKIWSKARNINEPSAGSLSS
YAYVILVIFYLQIRGVLQPRQVPTGTGPNGAIALADVLNHTLPFEGNNIYFGEAPDTPAA
EHPRLAELLLGFFHYYGHVFDSAKYVVCIRLGTPMPKAVKAWGKTKRGGEKIKFVAPKTA
MLEIEDPFIPTHNLGRVLRPESSDHIQSEFLRAHELLAGGGTFAAVIDTKGAIEVVKPPV
PAFGGRGNGGGGRKGRSGGKGRSQQGNGQNRSTKTNNDGNRGRGGRRGRGANDGAKRGRQ
KASSQGQGTKNRSRGEGGRGGRGGRGGRGGRGGRRGRGSRHRNWRNGRRGGGGGDKGGDG
GGGGGGGDS
Download sequence
Identical sequences A0A0L0DNJ1
XP_013754263.1.50528 AMSG_09846T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]