SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_10169T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_10169T0
Domain Number 1 Region: 3-239,361-426
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 2.62e-64
Family Protein prenylyltransferase 0.000000792
Further Details:      
 
Domain Number 2 Region: 464-559
Classification Level Classification E-value
Superfamily RNI-like 0.000000000416
Family 28-residue LRR 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_10169T0
Sequence length 570
Comment | AMSG_10169 | Thecamonas trahens ATCC 50062 geranylgeranyl transferase type-2 subunit alpha (571 aa)
Sequence
MLHGRLKKKTPAALEAARAAKVAARVKAYRACVAKAMESRQAGSNDEAALETVTRALEMN
SDLYSLWNYRREMLMARMADGRAEPADTAAVELAFTARCLRSNPKSYWLWHHRVWVMEMD
GYTPDFAEELRLCGLMLDADDRNFHCWNYRRYIAGTAAVPDADELDYTLDRINANFSNYS
AWHYRSHLLPRIHGPDFAASDSSFATTEFELVQSAFYTEPDDQSAWLYHRWLLGRSAAPP
RLTAVIALPGPAPILALVFSVPVAGVAPTNVTVAPLPPTSPPLRWRPAHSGRLAGGLSPV
WLATLDASPATLSVAVNTGPGIAAKDGSPLIDGVAMNAELELPGPATVVLELDAQLAAAA
AARSDLLARELAACDELLDLEPDAKWALLTKAFILEALDPASPVLDTLYTCLLDVDPYRA
GFYRDALSRRTLDAALADHDSASLSFALPAAGLVALGPRTHALASATALDFSGNPLRCLA
GAEAFVSATALDLSSCGLRELGTHLADLPVLASLNLANNALHPDPAVAFAGLAGSPLAAS
LTALDLSGNDGYDTPAAAVAVAAIFPRLAH
Download sequence
Identical sequences A0A0L0DQZ4
XP_013753729.1.50528 AMSG_10169T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]