SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_10187T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_10187T0
Domain Number 1 Region: 73-138
Classification Level Classification E-value
Superfamily SIS domain 0.00000272
Family mono-SIS domain 0.019
Further Details:      
 
Weak hits

Sequence:  AMSG_10187T0
Domain Number - Region: 482-529
Classification Level Classification E-value
Superfamily SIS domain 0.000534
Family mono-SIS domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_10187T0
Sequence length 605
Comment | AMSG_10187 | Thecamonas trahens ATCC 50062 glucokinase regulator family protein (606 aa)
Sequence
MLRYTEQSNALTEELETAARSDVRGMLRLLRCSDNQVFTGFDGEEGLAGAVVREKVATTA
TELRAACTGAASPLVILSGCGTSGRLAFHVATSFASLVPDRARVAYLIAGGDYALLKSQE
RGEDDPHQAVTDLEQLIVGLDVVPDLVVYVGITCGLSAPYVAGQLDYVLAKQASEPAIRW
IAGLVGFNPVALARSSVIEGWTSSFKDVADALVASMDLPSGAGNFIINPVVGPESVTGST
RMKGGSATKMLLEILVRSALMGASDPAAEALHALDCYAATLRSVYQGENMEVLARLVEAG
GASLRSGAPIYYVGSDFGVGHLGIIDASECPPTYGASINDVRGFVDGGWAALGNRNGDLS
LAPKDDGFDWQLSTTFLLDELAPALADTGATVVANLPVDTDATKLTDAAATLAALGSIPG
VTKIALTVCPAHKVESVGVANAAAVAAGFEPCVVTVTTRSGAASAPLLADSDSWDFLYTE
LGYKLSFNALTTGAHVLRGKVVGNRMVDLAVSNSKLFARSRGIIAKYGQVDEAAAEAALL
RSIYADSVPANVDDLPESAHIKQAMKRVRVVPTAILLAAGAAESVAGARALLDAEPMVGR
LIASL
Download sequence
Identical sequences A0A0L0DRM0
XP_013753395.1.50528 AMSG_10187T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]