SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_10361T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_10361T0
Domain Number 1 Region: 656-919
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-47
Family Protein kinases, catalytic subunit 0.00058
Further Details:      
 
Domain Number 2 Region: 59-207
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000157
Family 28-residue LRR 0.088
Further Details:      
 
Weak hits

Sequence:  AMSG_10361T0
Domain Number - Region: 1024-1065
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 0.00235
Family Hect, E3 ligase catalytic domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_10361T0
Sequence length 1482
Comment | AMSG_10361 | Thecamonas trahens ATCC 50062 serine/threonine protein kinase (1483 aa)
Sequence
MYHLKTTTRPSGVASALATSPAGLALHPPDHTPPSLSLQLVPPSDLVLVFGENAEHAAAL
KTLSLNGYTALRSDDDFDALLATTPSLTTLSLVGCSGLSDSALAIIAMRLPNTLTSLDLS
HTTIPTPAGLRELCAAVDGLAELKMGFSSADDEVLKILGQEAASLTAIAVPHCSNISDEG
VLSVTTPDAACALAALDISSCILVSPPVLEHVAAVEAAAANGAERPAFAPVPAADELAAA
ASAGSSAIAELVGVRSTLDELHTRWADLAESTVLPEPIQVTTALAGTMDAYLDAAETKAA
ASERAAAEAAKAAAAARAFTDARSVVVAKMEGVCDGGQDALKTALEELEEADALAARDNA
LEAAAAASAAAEEAAEDRTATLSCAARAALALVEGAEEYHSEQVREASLPSRDEWVAVLR
AEEAHADHVTSVLAPATSDAVAALSAAVAAFDKAAAAVETAVDLRRAANEAAVSLAMRLT
PQAAAELNVEYAAAAAELQRAHFDTQHIQALLALRHELEGALQTLPELKETMYVLDTELD
QNGLAIRGVKRKARRRGRDSPAELAKLEARKAELEAQLAAVQDQAVDVSSLFESTAAMEY
FPDVEARAHLPSYLARMASSMAGPSAPELSAGATADDYAPVAGGTLKKTGVQGDMHVYRA
IHGPTGTEVVVKTMRTGVAKAANHELLKQMRREAATTSRLDHPSVVKVTRVFEGPDSVSI
EMPYYPGGNLRTWVADKNVSIAAGGDRLLLAVWRQLSSALAHAHAAGVVHRDVKPDNVFV
ADPAVPQVVLGDFGIAKAVESTQTLGATLMTTVGGFGFGTAYYAPPESREAEWSKLEHPY
AVDVYSLGVILLEHLTGAHVAQLPLGDPEQISAALDAAVGSHPVLSLLAPVVASMVAVDP
ATRPTMEMVSAVIESLVPKLDALAASRARTTSRVHALHAQRTARHQVRSGDSSLAPKVWD
VVDGSDAAAVLQYVGAADEETLKARVTAIGFDTLDEAVASVCEAIKADPAAFGCVAGANG
TLLVDDVDTARALGLLIGKCVVEGVHVPLEFAGVVYTMLAGGPDTAAVEPRLPSRDPTHH
LDALRWASWASAWTGETPGAASETYEMLIGVRREALFALHEAMWRVLAMGELAVHAALLT
PDDLQLAVLAPTAIDRDGLLAAVSWLEGDAADHDAAVRAKERWTTLVLSLEEVAVQLLVS
AVWGVAGFGGCGFEQVTGVFGGAVAGCERGLLTLPHLVDDDAMFGSLVLGALGLMAPATE
RCVVCGDGFRADEGMACRVATGSAAHFLCRKCFGDRVKASLTPDAIGEFKAAGCMIKCPM
AECPAEVFSLNDVSRWAPESFVAFVDLRQEVFQAKLQQEMEARARAELEEALKADAFDRD
VHAATLHIQNNILTLRCPRCDAAFATTRDAQRSAATAATPASQCRLNPNGQSYYVTEAQF
KAVHRGRQQQAVTAYLGGLDGAVAAKVREMRAQDFADLGIVV
Download sequence
Identical sequences A0A0L0DQD6
AMSG_10361T0 XP_013753535.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]