SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_10406T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_10406T0
Domain Number 1 Region: 20-213
Classification Level Classification E-value
Superfamily RNI-like 1.96e-20
Family 28-residue LRR 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_10406T0
Sequence length 649
Comment | AMSG_10406 | Thecamonas trahens ATCC 50062 hypothetical protein (650 aa)
Sequence
MVSQPTRKTSLLTLDGLSLGSCPTVLADAFMTSRNLHSLSLEDASLTPSALCILATALQS
VESLRYLSISRNLKVKVKDNAGALDALAALVDMVPLESFVLQGGPSKYRLGHETCVPLLN
AFETSASLTEIDVSGMGLGDQGAYALARAVQSPSSSMVLLLADDNEFSFSGLHKLFRAVG
ASKTMLQFPLPQVDLSRFSSAKSVDPAQKQTLLHDIAMMDDTLDANERGLARAGKAADSD
AADAATVEASASDSASLSTSIEGTRVQAVISGETRRRGSSGSSAYGKIQLGRRDRSDSTI
SLINCGMLRREDLAAGEYEGLGLGPELGFVGVRQSVESFDDDEVHRMLADDDERVGSIRG
GEASQVVPAPPPLPEFENSFANRTRRRTKNRMILKEKRAKARASRGREVSCYSMTLSSRD
AEVVRRSMSGSSSSLQRELDALESAGLDVHGPSYAPVVSSPLVSSVVSTAGQSPIVSPTV
TADSLSDDDELIDLNEAAAAGKIAGPPRPTSSSTAVAAEFAEAMESVNAALFPPDSQERL
SRIRAKGSLQNLPLLDDASSSHPSSPAGSFTGSPPVSAGTSLRKGSSSSLNIDVDDDVDA
DVAAELADLEGMGHSTLKREKVKLNTQFDTIRRNAIMQEAEDELADLLS
Download sequence
Identical sequences A0A0L0DRB3
AMSG_10406T0 XP_013753571.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]