SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_10500T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_10500T0
Domain Number 1 Region: 311-624
Classification Level Classification E-value
Superfamily RNI-like 2.43e-34
Family Rna1p (RanGAP1), N-terminal domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_10500T0
Sequence length 1337
Comment | AMSG_10500 | Thecamonas trahens ATCC 50062 hypothetical protein (1338 aa)
Sequence
MAVCVAEKSAGADPLARGQKLILSTSDSSEPSIELDSRNDATQMTEFLFSGSLGGSPTGG
ARSLQLPLFFMENDPCGNSPDPPAHFVGKMAVLIIFEPVFDNDELNRKLATCDVALLAQK
VSQWGAKGLLVAPFALGLDTEYSVNGYRKSIAGSPSFLNDLPSDFVAYILRNEDEFKSAI
QPYRDAGANGRLSVEVTQSPMVASERDALVSFYNTSGGASWAFPGENRNGKPWRPYNLLS
DPCLDNWYGVVCTPDGYVDMLMLAALDVTSPAMPAGVLALRAPSYIDLADCRIGGSLPFF
PSTWNEALVGLELQNNYLEGPIDSGQLRPLTALVILNLSFNVLSGQVSGAMLPTSGALAQ
LILDSNPLGGTVPIINTLPQLERLSMGNTQLSGTIPSGSWSLANVNLASNNLTGTVPSDL
LYAESSPLLRLDLSNNQLTGFASVPLGTNQEMIFLQDVYLNDNLFPIMPTLWPFNMTLRD
VDLSRNKLRGALSFGGAMDNIQIVRVAGNELTSISAQFKSQVPNLNAFDMSSNNLTELGR
AIDLLPLGLTSLDMSDNAALMGPGFSLARIYRSMPNIRTLDLSDREAFVHLQSLDLANNL
LTGVVPQLLGEMPALRSVDLRGNEALRAKLGPGPFLPAFLTPDYNAADTTVLAGGACPSF
MSSRGMEVKVDPGYHRYLMCRCRENYYNTSLGGTSSCALCLANAECSGHPEVAVPRMVPQ
SGYFPSTVMRSVINPFALTVPGTGDSSVGPAARAAVSVSSLFNASVTMTTTVPGEFVACQ
YGSMKIDDPANPCVVTASTADGGSETEAFDCRAGHTGRLCAECLDGYFSRNGECILCVDS
AGVWPLVFVLTVLLILVVLIAVAMFRDIIPRNVRRWDHILSESWRCWRAKRWASSEQEEQ
ETSVSHSSGSSSGSSSGSATSTGSGFDSASAAVSAPEATPAPATVGGSEHVPGKLRRKAF
LRYMQQIVQVVIMFFQTLTIVVADLSLPDAVVPFVALFRFSQPSTEGLGLECIDEFRTFE
QRYKTMLVLPPILMGMLITVFGIRFVLRWQSARADAAAKAVMGDAFDEDSEGYTWVMESG
LSSAASSDSGSASEAQEEAGKWKIWSDSVEAEELAQMGKVFLGHVVWAVGLQDPVSKISY
LKNYPHIECAMLTTAEKAVPMVVYVVIPVVALVSIVVYSEIVERVPRWMTTAFPFWFDAF
KARSRYFAVLFVGRRLVFAAVVAFGSVSSIYRHVVLIGLFLVSILAAYDLEPYVSPLVTR
MDMTAHVVLLMAYTTAVLADLLDVAGRDASFAATVFGGLGAFGVIVIGAALIIPAYRVFV
RKTWHEVGGGAQVGVLA
Download sequence
Identical sequences A0A0L0DQC3
AMSG_10500T0 XP_013753655.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]