SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_10637T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_10637T0
Domain Number 1 Region: 9-175
Classification Level Classification E-value
Superfamily Kelch motif 2.22e-22
Family Kelch motif 0.015
Further Details:      
 
Domain Number 2 Region: 372-462
Classification Level Classification E-value
Superfamily RNI-like 0.0000000251
Family Cyclin A/CDK2-associated p19, Skp2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_10637T0
Sequence length 609
Comment | AMSG_10637 | Thecamonas trahens ATCC 50062 hypothetical protein (610 aa)
Sequence
MSSPLFTSLPSPLVCELKSNTWSLLVPPRGSYIPTPRHGHAGVLSADGTRVYIIGGITSS
APLGSPDGYAAPPWIEVFEVGTGTWQLLEAMDGEAPVPRLLHGAAMAAECLVIAGGLVWH
DDALCLTTSISVFDLTTHTWHRHVAELPEAVMAPSLVCVGDSRVAVVGGNVAVNHAYTTF
GWLELTRSVSGDISVTWHAAACSLSDDGARTNRCLSISATPLEARGGGGMLVVARFATEM
VCYVLDAELTQLRRVGPAFRLGLSQDMTLSVLAGVVSEDGRRVVLVPWIDLSVHDPSLKL
PRMATAKKLLRTFVLDDAPIKGPCSLVALGRTAVVKDALDTVMTSPSVPPAMVAELVAEA
RLRNSLQPIHVGLFRTLSVARISWVDVVDDDWLKSLVHACPHLVELDISGSKGVTSDGLV
VLGALPCLERLGVAHMEATQHENTIDDLLLNLPQIRQLNASHLHATYGVHQSRDAHREWQ
EVVRRLDQFVLDGRVLTVPMAIELAELNARAVSVAGCGLLFLPNLYNEIRLGFGTSFTDL
HSYYGAMEREHGMVLDNDLRELWTHRLSSFCIAADQPALMSEIELLRRGLSVPDIDMLYW
LDSDEDDDW
Download sequence
Identical sequences A0A0L0DSN6
AMSG_10637T0 XP_013753347.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]