SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_11084T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_11084T0
Domain Number 1 Region: 800-1103
Classification Level Classification E-value
Superfamily RNI-like 2.67e-54
Family 28-residue LRR 0.0049
Further Details:      
 
Domain Number 2 Region: 342-453
Classification Level Classification E-value
Superfamily Second domain of FERM 1.31e-16
Family Second domain of FERM 0.0023
Further Details:      
 
Domain Number 3 Region: 694-856
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000000361
Family 28-residue LRR 0.047
Further Details:      
 
Weak hits

Sequence:  AMSG_11084T0
Domain Number - Region: 260-339
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00728
Family Ubiquitin-related 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_11084T0
Sequence length 1118
Comment | AMSG_11084 | Thecamonas trahens ATCC 50062 leucine-rich repeat protein (1119 aa)
Sequence
MSSDSDSSDMSGTFSSSEYGSEASPVKSKGKSKDKTKAKAGDKGNGKVSAASPDVASAED
GVVTSGGISQSGDQSADAPPPASGAGDANESAGSDSDSGLSSGSDHDAPKAPSSVPPPVP
TSRPKFQKRRKERPAVAPPAPPSATTNSAGSDSVSASDSSPAPQPPAVVDGARSDSGSDS
ESDTGAGGAAEGSGKGKEESDGVLEAVATGKDANRARVRSVLHISDDGLPSSRTLTPAPE
ELLKKDSLLDSVELGGESLVVSVLTMSGTKKALKVTTNVTVQLLKEEFARRIGMYDHSLF
ELVDAADSSADRWLDPTARLGSLGLDPAAAKITLKVKYWKEPRTLTDPKAITLMYEQIQH
HLVAGTWQASEGQTLLLGSYHIQAMFGDFVSTETTVSYLDDIELDEFLPPWLIKVMPKSY
YEMRLARLHERLAGKFADESAARAQFIEVARQLPSFGLTMYMVSSKRGRALQIGVAEDGL
FVLVPSRSRVGSSSANASAVTELERFIPYTRLVAWRASPTGTSFELECKSQGRTVGAEDD
VLESGVERITFHASRTVVDSILGLITAYYRLLLHGGLLGEERAAREAELDVDWAAYEQAL
PAPTVFNPPARRKLTWSIFPSRLEVFKHMLMQVFRTEGLAPVVKLWHDADLAIDTNRWIG
TLELYQAGLTSATLKGVMTAMVQTFSFESASGELVENFNVEHLLLGSNAVDKVGTPHLGS
ALTSPSLMRLRLRRSTSRTTHRSSLVKLPFLADLLLAGCDISHKGATALFEALAGHGTLE
RLVLARNKIADDRGWGQPLKAMLQHSQALTELDFSSNKISDSGLDALLGGLMLSASLVHL
DVSDNKFSSKVGKNLAMYLLAPSVKIRSIAVGACKLSADVSAEFGRVLAVNTQLTCLNFA
GTSFGKGGPLAVLDVLPASRSLVQLDLSGTGLDSKSMSSLAAAILGNATITDLNLADNKL
GSGKLALKAALAKNKVLARLDLSNNGLKSSDVDDLAGSLERNATLKVLILDGNSYGNHGL
EHMCRALQANRGLLTLSMARSKVGDKGLVLLPAAFSNNKFLHNLVLDGNSITDSGLRYVL
DALSRNNTLATLSLEGNSLRDTTAFAADVADMTTVIYV
Download sequence
Identical sequences A0A0L0DT69
XP_013752961.1.50528 AMSG_11084T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]