SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_11147T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_11147T0
Domain Number 1 Region: 288-368,398-657
Classification Level Classification E-value
Superfamily RNI-like 1.9e-54
Family 28-residue LRR 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_11147T0
Sequence length 991
Comment | AMSG_11147 | Thecamonas trahens ATCC 50062 leucine rich repeat containing 16 (992 aa)
Sequence
MSDEEFDPALSVPEISDADLKYVDKQLGGKKSFLTTWVVKVNRKGKPDQRVMVISEHFLF
IIKKAALGRKVRIKVHWYDLDEIQYQPPHHVLLVFGEESVELKANNADDIIDAVREAYAP
ITLGFPDEFLYDYRAPDSAFAAEVSVGFSPAGNFAVTYEAWCAYLKMPVLQPILDSIRAA
VTYGTNVVDLTSILNTGKDPPSKEILSAILPLFRALRFNTWCEKIALDGTQFVVPKRLGP
LIPMLADTLEHNSTIETIDIRGIESSAWAEVAEELGDSDDHAVGGFVLPSNQLGDKIMTA
FAAVISKMETPLTAINFANNACTPKGMCALLEACASAVAHLKPVAEINVSDNRLEESGSR
ALADMLRVLAATDAESASTPIDPASGPDASNLYDRLTSRVRLVTLSLQNTKADVRVLVSA
MRELPSLESVNLSGNEIAFDAVQELVQFCASSQRLKVLGLSSCGLDGDTVQSILQALISN
VSLPRLRIDISNNNLSFYGAQKIADTIRAATNVHTLNISSNALTSEGIGVIVDAVISVSS
LQALSLSNNLRAGTDAEEGAGHLARLLTAPTNIRVLQICGSRGGEMGDAIQTVFKALARN
RSLWHLDISDNEMGDEGMEALCKALAKNASLQTLVWDGNDVGLDGWELFLSTLNEHPGML
MEVEEPKEDIKKLSKKGGALVGRGRILVQDVLSITQRTRSKYSDRSDRIPGDWPVDPVSL
RFYFDYLKTLKSGADAEDPMASATGPGGAAMAVGPGGAAMSGAGPSGGGMVGGGMVGGMV
GGGMVGGMVGGGPGGGTPGPGGIVGPGGLVVGGAPNGGGPGGGMVGGGMVGGGMVSGGMV
SGGMVSGGMVSGGMVSGGMVSGGMVSGGMVSGGMVSGGMVAPSGGAYMSSYGGGQSYQSD
GAMMSGMPTYGDATTYGGSTSFMPSQQGMGMPQQGMGMPQQGMGMPQQGMGMPQQGMGMP
QQGMGMPQQGIPQQMQYSSVNAGSPMYPQHQ
Download sequence
Identical sequences A0A0L0DU18
XP_013752903.1.50528 AMSG_11147T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]