SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_11235T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_11235T0
Domain Number 1 Region: 21-346
Classification Level Classification E-value
Superfamily RNI-like 3.53e-66
Family Cyclin A/CDK2-associated p19, Skp2 0.01
Further Details:      
 
Domain Number 2 Region: 307-480
Classification Level Classification E-value
Superfamily RNI-like 1.26e-32
Family Cyclin A/CDK2-associated p19, Skp2 0.012
Further Details:      
 
Domain Number 3 Region: 530-683
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000691
Family Ankyrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_11235T0
Sequence length 819
Comment | AMSG_11235 | Thecamonas trahens ATCC 50062 leucine Rich Repeat family protein (820 aa)
Sequence
MGGGNSNKSFTDAMAAVVAEMCPNLTSLILRSCTKLTDAVVVAVAGGCPNLTSLDLGHCT
KLTDAAVVAVADGCPKLTTLNLDSCSNITDAAVVAVAGGCPNLTTLNLHGCRNITDAAVV
AVAGGCPNLTSLDLYNCYDITDAAVVAVADGCPNLTSLILGDCTKLTDAAVVAVAGCCPN
LTTLNLHGCRNITDAAVVAVAGGCPNLTSLDLNGCSKLTDAAVVAVAGGCPNLTTLNLHG
CRNITDAAVVAVAGGCPNLTSLILGDCTKLTDAAVVAVAGGCPNLTTLNLRGCRNITDAA
VVAVAGGCPNLTTLNLTACSKLTDAAVVAVAGGCPNLTTLDLTACSELTDAAVVAVAGGC
PNLTTLDLGNCSNITDAAVVAVAGGCPNLTTLDLWRCSKLTDAAVVAVAGGCPNLTTLIL
RSCTKLTDAAVVAVAGGCPNLTTLDLTACSNITDAAVVAVAGGCPNLTSLNLGNCSKVTL
DLHRARTAIAEPGFLASQHARALVGVVTLANSPELLQALTHFCHRAHVPSPVHLMARCNA
LSPDTLNMLLAYGADLYDLDDDNKHAYVHSPASYAPAFVGLMIESLRANADGGDELANGI
NKATLTLFIALHASDMTPFPIPVFAFLINTGADINALEPSLGLRPLHIAVSLSNIQATMA
LLAAGADVWSLGANAETALAIASTVLNKPGSDTNAAAKEVYNLIVNGAVPEPVALYVRDT
IVAGGDIGGAAGPSTGTATRVDKLEAELADTKAKLAATEAELAAELADTRAKLAATEAEL
ADVRDHVTIATGNIAAFQTDRANILQYVDNAIAAFQASR
Download sequence
Identical sequences A0A0L0DTY9
XP_013752824.1.50528 AMSG_11235T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]