SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_11241T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_11241T0
Domain Number 1 Region: 128-356
Classification Level Classification E-value
Superfamily RNI-like 1.28e-39
Family 28-residue LRR 0.03
Further Details:      
 
Weak hits

Sequence:  AMSG_11241T0
Domain Number - Region: 70-152
Classification Level Classification E-value
Superfamily RNI-like 0.004
Family Cyclin A/CDK2-associated p19, Skp2 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_11241T0
Sequence length 376
Comment | AMSG_11241 | Thecamonas trahens ATCC 50062 F-box/LRR-repeat protein 20 (377 aa)
Sequence
MAMDVTPLIVAGAVALIIMVASKASKATAETMDDVRTVKLEGCMTAAEAGDWVAKVGAEE
VRVVIGGAVDEVLIHVVSMCSGITDIILANCSALTNASLYAIARCCPSLKRLDLCNSGLP
SADTLAALIAGCPLVVDIDVTCCTLIKDDAVEMMVAGWQLERLVLTGCEDVSSRGVEAIA
AAGAQLKVLSLSRIAQVYDDGLIAIAAGCPQLTSLMLQWCAFFTDVGLLAIVAGCPRLTR
LCLDRCTRLTPAGIAGLVGLTDLVELDLTDCRSQATDDALAALAAGSPQLEQLLLHNCTA
VTDAGIEAIAGGCTQLEVLDLWGCTLVTDTGAAALFDLARLTRVSLDATKISSAMKTAVE
GHCTAMAAGMATAGSA
Download sequence
Identical sequences A0A0L0DUR7
AMSG_11241T0 XP_013752830.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]