SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_11290T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_11290T0
Domain Number 1 Region: 72-388
Classification Level Classification E-value
Superfamily RNI-like 1.88e-29
Family 28-residue LRR 0.048
Further Details:      
 
Domain Number 2 Region: 5-57
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000497
Family F-box domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_11290T0
Sequence length 550
Comment | AMSG_11290 | Thecamonas trahens ATCC 50062 hypothetical protein (551 aa)
Sequence
MASAQHLPREILLLIFSHCSTLTRIRARSVCKTWHAAVSDPYLWKTVAVADMLIPFPAVD
HAWLSTFAEAPYLSAVTTVDFSFCVAFDGHMLAKLASLMPRTTSLVLEGCTALGPSSLAL
LAPPSSHFPSLTSLNISSISKLNMGNETLSLLRSLPTSLTALDLSRTSLLFGYLPLAHLT
NLSSLIMRACTSTGLSWHAALPDFSPDQMLSPSLTELCLDESRGFNSRRITQALTHVTAL
KTLSVRRCSSFSGTAIADVLAQNPNINKLVADNLSVGDQFAQHLAATCSSLTSLALSFTS
VTDVGFTHIADANPKLRLLNVQFCSLNPALFSSLVVRLPALTSITLSRCHVPTDGIFAIA
DSCHLLQHIDLDPAFVEAHAIYYLVEQARDLVRINGTPIDDRDAWSIITGDTPITPNSIH
AVRLKDGVIGVELGLRFPDLDLDPAKLFGLAPLPSLRSSSTSGAALPTSARAADRGVQNF
PFRPTRVKDSSRDTSVVIHCIVAQEPYRDRAVSLEELRAHYYACYANAACRPIAWTTVAA
ALDDKPALPS
Download sequence
Identical sequences A0A0L0DUH4
AMSG_11290T0 XP_013752773.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]