SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_11406T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_11406T0
Domain Number 1 Region: 30-184
Classification Level Classification E-value
Superfamily RNI-like 1.94e-22
Family Cyclin A/CDK2-associated p19, Skp2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_11406T0
Sequence length 202
Comment | AMSG_11406 | Thecamonas trahens ATCC 50062 hypothetical protein (203 aa)
Sequence
MCGIGLHRAKSSMASLPWLQTDQRAALRSDALPVLARLVPQLEQLDLSGALRIGGGELES
LLASASSLKSLSLARVPGVTDAALEALVSAASGSLTAIDLFDCRKITDAGLSALAQCTQL
QSVVLAGCLDVTVTGLAALADGAPGITTLSLAGLLHLSDSDVLETLGPRLAALTSLDVRF
CRSIELRHDMGELYEALAASRA
Download sequence
Identical sequences A0A0L0DUR0
XP_013752709.1.50528 AMSG_11406T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]