SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_11566T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_11566T0
Domain Number 1 Region: 58-184
Classification Level Classification E-value
Superfamily RNI-like 0.00000012
Family 28-residue LRR 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_11566T0
Sequence length 213
Comment | AMSG_11566 | Thecamonas trahens ATCC 50062 hypothetical protein (214 aa)
Sequence
PHPVPMEGSDPPPSPDNGPDPPPSPDNGPTPPSSPEYGAGPSNDLTIALQNSRETNWPST
LAHLALTGTSPSSDDIELLCNRMQCLTTLCIIRPASPVSASFLAGVAAASRLTTLTVIDC
PMTPDVLADIVESCTRLTKVRIAVDWGTTLWSQFVSRVILPRVNAQLPVWPQLSTLDLRG
CLRCSAMEDYIVPHLPHATVMLPAYSRDAAFAF
Download sequence
Identical sequences A0A0L0D3F8
AMSG_11566T0 XP_013752588.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]