SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_11574T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_11574T0
Domain Number 1 Region: 43-77
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.000000187
Family Putative zinc binding domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_11574T0
Sequence length 94
Comment | AMSG_11574 | Thecamonas trahens ATCC 50062 hypothetical protein (95 aa)
Sequence
MRACGRGSRHSGEGIHEACGIIAATESAQGSPEEDSTLARSPHNCNVCNVEWATVTNPLS
EPIDVFTDWIDTCMEENEGFRPDVDFDEDENIGY
Download sequence
Identical sequences A0A0L0D3U3
XP_013752578.1.50528 AMSG_11574T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]