SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_11625T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_11625T0
Domain Number 1 Region: 325-482
Classification Level Classification E-value
Superfamily RNI-like 6.15e-24
Family Rna1p (RanGAP1), N-terminal domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_11625T0
Sequence length 1198
Comment | AMSG_11625 | Thecamonas trahens ATCC 50062 hypothetical protein (1199 aa)
Sequence
MASIATGFAESGHLPAGDYVLHVANFSNFVGRFEYSFVRQSATDVTCSRGEEETISPGEE
WWHKFSVNAPSTFFSLQLVSSDGIAVEIIQLCSAVDLALAGGASTKPAPGGLTASRSIEL
PDGNYILRVNNASGQKASVAYSVTRRTPDGSGMVLSAPVRELQAQSDWWRKFVVQNASPA
LTFTLDVTSTGNTFEEVLLLGPILILDPFPIATKAEAGAAVPCAGVVKTSSGGAFAFCDE
TKCFNYEASKFSELATLSQFQAYKELWFPPGGPHSRFQLFDGPSFAPLGRSHESGWEVAH
DGGGVLASLDDIRKFLQNPYMTANNYTAIALTGTVLTPSDIDRLGEYLTSTLITRRISAL
VLAGSHIDDERLIRLLSGISPVLNYLDLSDNLVTDNGVVALSALLATSDYNLQYISLRGN
AIENLGAAALSDALTRNATLLALDLSDNAIGLDGAKQLQEGIRINHSLRSANLAGNAVGA
DVVDLLGRLAPNRLVDHVQWSWRCALDARGSRASAVGPDGGRTGLGAPRDVVAISPGRFG
AQTPLYVLTFAPPGAPTSAAADRMVVVRQSELEPGTMAVAEALAAGRAFLVPLPEGQTVA
TMATNASHHVAVATFEATILVYSGLSLLRALDQARSGGSCEVASMAQISTSTVAPCLASS
AQVLMPRFAPRGAARSGAGEAPTPAARLQSPAASSSGAAPWTEPQTKESVPVVAFAWVPV
LETVPCEAAVLYADGTPAIVSGGTVSALGCTSKRPPVSGVVSLAWGIAPMAQSHVTPRAV
LAMGLADGRVVLQRPASAMLLGTLSPPDELRGVHAAAHLRFLGSDVWLVGFVARSGSYVF
ALVHLRSGKGGAVAARWRVLGPQLFPVASAASLRRASQLTHVPLPVALFSQLADAPACVK
VSLSLPFPRLLVLGSSISPDVEVLTSTPHSDPLQTWRACALPNSTLFSPPSAGTGPTASQ
PTTPRVAAVSAASPPRMPVDFEDGMLAARCFPIAVAAVVDPAAGDEGRARLLPTSPRETD
EARKSREPRDGPHMRYEYEYEYEYDESPSGGDDDLRRHAVYSRRTKPGAVQRTEQASNYA
NLSTVETLHHLRLELPCVRVSLVCVLLSGHVLEYEFVVRQEKPVDQGPIKGDTYDLFASY
QVARKRLQASLQLPQPIGDFVDPASIRPPPHTRSSALDYVDHAVGGLFDRVAVSPLRP
Download sequence
Identical sequences A0A0L0DEW4
AMSG_11625T0 XP_013762604.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]