SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_11715T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_11715T0
Domain Number 1 Region: 1852-2009
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000000000208
Family I/LWEQ domain 0.0016
Further Details:      
 
Domain Number 2 Region: 366-454
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000148
Family Third domain of FERM 0.0013
Further Details:      
 
Domain Number 3 Region: 256-365
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000471
Family Second domain of FERM 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_11715T0
Sequence length 2072
Comment | AMSG_11715 | Thecamonas trahens ATCC 50062 hypothetical protein (2073 aa)
Sequence
MKFVFHYLGDPMDGVTGARSASKKTFKHMELSTPLSELLPKAAAAFKIRLRADHSFFLIH
PKRLDSVLSMLTLGRSAAAAAAAAKKSKKSKSKRGRHSILVDADDDWTSPLSKVDAALGE
WLNTERTLLELRFNPDAQNHLLFTRVTYPLRVVPALGEEPRVVISNYNDLVQDLIVPIAA
KFGVTNAISYGLVNTASMPAGNAAGQASAPLRYLNMLSDLPSQGVLPTDVLLFSKRLVTN
DDHAILDGALASSTPETDLDSVFAEIRDAILTDSYPVRIEEALQLGAVLLQEKFSNPPDD
ATAHRATIEGALAEVLPARHWKVDNVIAKLADAHVALNSKPGTGDMIPLSARKYFIRLAK
RLKTFGCTKFDVMETRSSGAKTPAVLAITRDRILRIHPKTNAIVTRFKLTQLAKWSSKRN
TVTLDFGKHASRPYVIDSPVPEQIVQLISGYVELRMQQDLSFDPHKAPPASPDIGPGGPP
RPSDAADLDARADAAVAKTDAAATKPDAAATKAAEVAALAMAAEDGAGPSGPAGLSGPPA
DDGDSPPPYEFADSSPVLHNADLASQAGPQAITLEDPKRVDAAAVTAGIATVHDAAASPP
KFGTEPVVKLLGLAPLASAADGDPSLPVAHLQQALAAFVAGVCKCLSMATATPLDAAKVH
KHLAFVSSLPPVIASAFLALADTPTASNIDPPLASTETFLALYTKVYAHLDALLESAQAL
TGVESEDKPRQAAMADEASLLGETMTTMTAAIGVHGVATSRITEISALAHRAAEVSTELV
AAAKQVAPSIQADPQALAGLVAAAKAMSLANTLLLPTALLTAPLVHRPDSFRLLASAAGQ
VTNAASRLAHRYPELAAPSLSVNTAVTYVLATANPNSVAAAMVSVSKALQELTEFTGDGG
VPPELPASAPETPPSRLTLLPLALKNEFGNSDAALPPGATADFITTSLAAATMYTKIINV
IPSVTGALVSGATDISLGLAKIGRALLEMERQTVFGASGAAATLMALAKPGTHAGALGAC
YIKLVHTPLERARAFLLAASTMIKAAQRLPYVAGTPEAAALVSSLQDQSAQLVQLSEAGL
ATLTSLLDASTEAGPEIRSSLSATLSHLEQCSVTLKLASTDLATATSAVRDAATTAGDGV
AAETAALGPVISHLPTVMELAPSAAPILLFRVADAVSALSDHGAMLARTAVGQAHDPSLA
LLDEAKSLTSHVEAVADLVLGYLGESAAHPSVGLKFDSRELWRKVKLIAGSTNKIGGHVK
AILALLPPGDDTEQPALSEAVARLAIQLELLDGAVGVLSSGCTDDAELEPFLDLAPEREM
GVASKSFTALRKEAMPAVARDLASLSVSLSQNVKAMAKSRSGLDVEADVLNIASELLSAV
LGASAIVAGVMTKLSEDSALMAAELTDAVTSLAHDVGTVIREVLAAVRDAPADSSSPFSA
TVASNIVSTTKGISSGISSYIDAVKAVTKAAAEAEAAATAEVEAEAEAEAAATAEAVAEA
AAAAAAVEVEAVAAAAAEAEAEAVAAAAAEAEAEAEAEAAAAAAAEAEAVAAAAAAAEAE
AEAAAAAEAAAAAEAAAIEPVDKLKALVAERLAAVANNTLVQVSKSEDTFTIAGAADALS
GLSGSGTVAAGEALGLKLADLATMLVDPIAQHDLLDAASSLAEALHSLAAADETTRAMAL
VRTLWCGIVGLLRAVQLELAQESSHGAAEAKPLTLTALLQIREMSRAVVSAVPTLAQTVE
FSDELHAAIDVVRKFALALATELAAPTSNAAPRPEWMSASAAKGERKAAHRAIFALEELV
SAAADGEEVDEQMQSVLAALGKFSKKTDKLIIAAEDFEDSTSSSDTDSTDEEELQHELDE
AAELVEAALHVAEEGRARSADAHLVDESLDVGAAAKRLVTHAAEMQKELEDAEAARPSVF
AYHSGSAWNRGLVSAAHEVASAVSDLCSAAVAAEAPASARVLALAKQVSAGSAHVLHAAN
TKAAPESKAIGKLKKACKELKAALAAITQLAHSERAVAAAASSPSNTIGPGTFTRTTSQA
RLIEQRQAVLEMEQKLEQERRRLAELHKEQYN
Download sequence
Identical sequences A0A0L0D5A7
AMSG_11715T0 XP_013759559.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]