SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_11735T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_11735T0
Domain Number 1 Region: 292-353,461-559
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 6.8e-36
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.0072
Further Details:      
 
Domain Number 2 Region: 139-288
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 6.07e-27
Family Poly(A) polymerase, PAP, N-terminal domain 0.071
Further Details:      
 
Weak hits

Sequence:  AMSG_11735T0
Domain Number - Region: 28-52
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00137
Family CCCH zinc finger 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_11735T0
Sequence length 597
Comment | AMSG_11735 | Thecamonas trahens ATCC 50062 hypothetical protein (598 aa)
Sequence
MCRFEHHHLPGSEGPSEAYPPPRHLADSARPFCVQEAVMGWCSHGLYCQYRHGPAPRLAP
EPAPAAAAGGQAGERAGDGDGNGDGDGDGDGDDEAAAAAAAELVEAKAAYAVAAAEYAGK
AQELACELVAVDPERAAGLAALMARLKESIEPRPSDESMRQAVCNAVHAFVEDAMPNLRR
GYVSTSSLHLFGSSANGFGSRSSDVDVSMEMRLPRNRIARSNVISNVINTLGKKMRAAPE
FARDVKWITGVKIPLIKFVHVDSGLSVDFSIGNSLALRNTRLQKCYASLDERVRDLMYTI
KYWGKARKINDAAKRTLSSYALTIMLFHYLQAGLVPPVLPVLQTMPGGSTEGGDPVRKPR
PPPTPDAAAEGESGKEGKGKVPARKDKGKKAGSGGGDEAGGADSGSRSGSGSDSGSDKAE
DEVTKPRVFDDSWKRDESRDPSLPSVRINGYETYFCNSLPAVRTAFPVGANAAPAAQLLL
GFFDYYANSFPVETHVACIRRELGHSLTKAEKSWESAMLAVEDPFELNHNLTAMVSGEYW
ELVHSEFVRAYNLLFGYLTRAPHTPDRSPDGFMDVLCAILPEREFHYEAPPKKDGRK
Download sequence
Identical sequences A0A0L0D2Y9
AMSG_11735T0 XP_013760484.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]