SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_11885T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_11885T0
Domain Number 1 Region: 84-356
Classification Level Classification E-value
Superfamily RNI-like 1.45e-42
Family Cyclin A/CDK2-associated p19, Skp2 0.04
Further Details:      
 
Domain Number 2 Region: 442-537
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 0.0000000000000301
Family Thiamin pyrophosphokinase, catalytic domain 0.0036
Further Details:      
 
Domain Number 3 Region: 561-604
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.0000000955
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_11885T0
Sequence length 896
Comment | AMSG_11885 | Thecamonas trahens ATCC 50062 hypothetical protein (897 aa)
Sequence
MERVRKITIGLGSPPMSARVHMEAVDDNAVRVMASLCPYLTAIELHGCDGVTNAGLLALA
HGAEMLERVSLPSGRNITAKGLAALAACRSLKEVRISWAEHLGDDALEALAECTSLTTIS
LDACTGVGDAGVAALASGCGSALTSITLSGCDQVADGGLQALADGCPRVTSAGIIALADS
CPQLTAVDVSDCERVGDEALAALAIGCPRLETLRVAMCPSVSAAGLRKVVDGCSALRVLD
VTDCARIDDEALAVLGGCRALAHLDLSRCTQITGSGLAALAHGSAALAKISLEGCTQVCD
AVLDVVARSLPSVTALDLTDCHQVTDNGVEALASGCPGLVDVNLTACAKVTDQGIISVAD
GCSGLERISFLQCPLVTDASVRALLVLKRITPRLVYTLPVVIVGAGELNLETLDQFLAAA
GDERCGAVDEASSTRHGERVAIVAVDGGMDAIAQARPHLAVDALVGDLDSVSDAAEWKAA
GVRVVGLTEQDTTDCHKVLRVVHAPLALMVGFEGRRVDHLLAALSAVASAEQRAVMAVGT
DLAFRLPAADSGESFAIDLPPTTRFSLFPLGHVAGLVSTGLQWPLDGIVFAPAGMLGTSN
AVVAGSDSVGTLAQDDGQAVTVRITATEATGPMLVILGLAHLDAAMSLCNRPHSTTMLSL
SDAASANSSDADANVDEYDNARSDDMQSDSGSGKDKRKRMRKGKNKSKRGQEQKQKHARD
ADADAEAGDRRSVPHVPSAMAADPAAMAAKPIAASAFVMVEPAAVAAAAASTASDASSSD
ESTSSEKPPRKRTRKSVTSRRTSDAATAQAHMHLLSEIAGPYFGDCGLVPGVEIAPAQSQ
GGERPRVIGLSQFHIAPHLVPNLSVPFTLEFSASYPSGQPAFSYRISTHPAAHPAP
Download sequence
Identical sequences A0A0L0DAY5
AMSG_11885T0 XP_013757759.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]