SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_12050T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_12050T0
Domain Number 1 Region: 1296-1510
Classification Level Classification E-value
Superfamily RNI-like 1.45e-25
Family 28-residue LRR 0.028
Further Details:      
 
Domain Number 2 Region: 22-169
Classification Level Classification E-value
Superfamily Nucleotide cyclase 0.00000000000000249
Family Adenylyl and guanylyl cyclase catalytic domain 0.015
Further Details:      
 
Domain Number 3 Region: 763-871
Classification Level Classification E-value
Superfamily Nucleotide cyclase 0.00000000000863
Family Adenylyl and guanylyl cyclase catalytic domain 0.011
Further Details:      
 
Domain Number 4 Region: 515-659
Classification Level Classification E-value
Superfamily Nucleotide cyclase 0.0000000000089
Family Adenylyl and guanylyl cyclase catalytic domain 0.016
Further Details:      
 
Weak hits

Sequence:  AMSG_12050T0
Domain Number - Region: 283-394
Classification Level Classification E-value
Superfamily Nucleotide cyclase 0.000942
Family Adenylyl and guanylyl cyclase catalytic domain 0.013
Further Details:      
 
Domain Number - Region: 1165-1234
Classification Level Classification E-value
Superfamily F-box domain 0.00163
Family F-box domain 0.0041
Further Details:      
 
Domain Number - Region: 1003-1137
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.017
Family Outer membrane efflux proteins (OEP) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_12050T0
Sequence length 1543
Comment | AMSG_12050 | Thecamonas trahens ATCC 50062 hypothetical protein (1544 aa)
Sequence
MMAHSETLANLVNREDAIATRYESEVTVLVTDMSGFTRLTRKYGIIHFASLILKMRAICR
PIYEAYGALYILTEADNFLVLFSTPEDAVAAAIEAKTKMDEYTATVAEKDFQPIIGGYGI
GLGRDTILGKNHMLFGEARDVAFRLGEDVAADSDICVDHEVYDRIRDMPQFAKVKGERRI
DDEDGGDGRVHFVVSGKLSGRLKADKAIAAANAAAAKATDEFGVFTNHMLARLENERERS
RLDALIEEKYMHDYAVVVMGLDFAEETEKFGVMNSLGKMMNISTMVARILKKYDGSVIED
TIFRFDRVEDAVRATLDIKALFVFINESHGPDEQVPFKGFGIHLGKMLLVDGSDVHWGDP
LNTSSKLGEDVAADGELFITLDIHRKIRNVKSLKHLEFEKRSPTVSKVKLHSYVVHDPRM
RDGDPIDRFGRICWGDLLPSRSASSASGKGKRKGKRKGKSKGKRKGKGKGNDGSSSSSSS
SSSSSSSSSSHSSRSADSSACSAFEPDRHIRKYKGKHAVLVTDMSGFTRITRKMGIIHFA
SLIYTMRRLLIPLFEHYGAVTIETEADNFLVVFEDPLAAFSAAAQILPLLDTFNDRQSNN
DFKIVMGGVGVGYGENLIQDQRTGKLYGDPCDSAFWLGEELCEKRHMLVDANIHGAIAKV
KAVKKAVRFTRAKDTSFPAGESLTYYDCTGYAKFKGSYKLPSHALTTPRKPKSSDKDKDF
SRQASTGASWSLTPSAKISTMPSATVSKLGGVQKTIEVKSAAYRIVRPLVKANAGTMEEE
GLWIFRTPADAVRTVLAIQTAVHEYNEDKPEVDQIHILGFGVHSGTLLLVKGTNVHWGDP
VNTSSKMCEDHATGGDVYISQEVYEAVKDHRDLRELSYNHETKEISKVKLSIYKVDAASA
AGPSRRARRSSSSDSRDSRDSRDSRTPSRKARFTNNRSSKRADPPGASSRKGARRASVSR
RRAGSNASHNQGSSGRRESRTPGRPRRRSSRVHDHDRSSSELDEYEVAAAGLTQALAAAR
TDAAAAQAAAAAAQADAAATQAAATAATQLLRDELAAAHAARDAAEREATDLRASVHTLR
VALDAERAAAVAAERLHAAAASHTARLLGNSPPPPPADASRRIARLQRPLPPLPLSPPPA
SIAADSPPVPPTAVNHAPALTPDDAARSPASTWDALPASLLVRIVLVASPPESVLVPASR
VCWAWRKALIATPQLEAVWTALLSHTRFTDTSLHFAVPRLVRLAPKIRINPAGATDRSFR
YMGLLLGSVYGDDTSAMSVADSTLIAPPLSPLQHAWRPSPQWPAPWGGPPSLASLTASVC
RAVTDRGVQLLLADGGGAALTHLNLSACQHLTDKALAFIAAGAPALQRLNLSDVSHLTEG
GVAQLASTLGPSLRELSLAGCDKLGHAAATVLGSAFPALVRLDLARCVALDDDAVSAIIG
QASSAKLRSLSLASLPSVTDAILPLLAASPAAQACALRDLKLTGILTFTPSAIASLAHAA
PSLKTLAISLAPSADAASLSATVPPSLSLQIRSTGGSPLRRAP
Download sequence
Identical sequences A0A0L0DF70
AMSG_12050T0 XP_013756678.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]