SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_12055T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_12055T0
Domain Number 1 Region: 212-471
Classification Level Classification E-value
Superfamily RNI-like 2.55e-68
Family Cyclin A/CDK2-associated p19, Skp2 0.013
Further Details:      
 
Domain Number 2 Region: 402-625
Classification Level Classification E-value
Superfamily RNI-like 1.96e-59
Family Cyclin A/CDK2-associated p19, Skp2 0.013
Further Details:      
 
Domain Number 3 Region: 7-238
Classification Level Classification E-value
Superfamily RNI-like 3.85e-58
Family Cyclin A/CDK2-associated p19, Skp2 0.01
Further Details:      
 
Domain Number 4 Region: 750-796,882-966
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000581
Family Ankyrin repeat 0.0033
Further Details:      
 
Weak hits

Sequence:  AMSG_12055T0
Domain Number - Region: 660-824
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000426
Family Ankyrin repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_12055T0
Sequence length 1090
Comment | AMSG_12055 | Thecamonas trahens ATCC 50062 hypothetical protein (1091 aa)
Sequence
MVVVEMCPNLTSLNLNNFSNITDAAVVALPLVALAGGCPNLTSLDLYNCPNITDAAVVAL
AGGCPNLTSLNLNNCSNITDAAVVALAGGCPNLTTLSLYNCSNITDAAVVALAGGCPNLT
ILLLGNCSNITDAAVVALAGGCPNLTTLSLYNCSNITDAAVVALAGGCPNLTTLSLYNCS
NITDAAVVALAGGCPNLTTLKLYNCSDITDAAVVALAGGCPNLTSLDLCNCSNITDAAVV
ALTGGCPNLTSLDLYNCSNITDAAVVALAGGCPNLTTLNLYNCSNITDAAVVALAGGCPN
LTSLKLYNCSNITDAAVVALAGGCPNLTILLLGNCSDITDAAVVALAGGCPNLTTLYLDN
CSNITDAAVVALAGGCPNLTTLYLYNCSNITDAAVVALAGGCPNLTTLYLSYCSNITDAA
VVALAGGCPNLATLNLYNCSNITDAAVVALAGGCPNLTSLKLYNCSNITDAAVVALAGGC
PNLTILLLGNCSNITDAAVVALAGGCPNLTTLSLYNCSNITDAAVVALAGGCPNLTSLNL
SYCSNITDAAVVALAGGCPNLTSLKLYNCSNITDAAVVALAGGCPNLTTLNLSNCSDITD
AAVVALAGGCPNLTSLDLENCSKVTLDLHRARTAIAQPDFPASQHACALLGFTQAHVPHP
VHLMARCNALSVDALNTLLANGADLYDLDDDNKHAYVHSPASHAPVFVGLMIESLRANAD
GATKLANDINKATLALFVALRASPTVPISADIVSELVTAGADVNAVEPTFNTPVFHVAFT
LAKHGALKALLEAVAALDVVLDQSAVDGNGATVLDTIIAANQLTAERMVELGGVGIDPFT
LQPDTTHVYVAAPVERSSAFSSAMVAWIREHGDGATKLANGINKATLALFIVLHAADTIP
FSIPAFAFLINSGADINALEPSLGLRPLHVAVSPSNILATMALLAAGADVWALGSNGETA
MSIASAVLNKSDSANNLATKEVYNLIVTGAAPEPVASYVRETIAAGGDIGGGADASAGTS
TRVDKLDAELADTKAELANTKAKLAAAEVELADVRDHVTIATGNIAALQADRANILQHVD
KAIAIFQARR
Download sequence
Identical sequences A0A0L0DFW7
XP_013756294.1.50528 AMSG_12055T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]