SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_12138T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_12138T0
Domain Number 1 Region: 144-281
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.93e-19
Family Universal stress protein-like 0.0044
Further Details:      
 
Domain Number 2 Region: 7-135
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.01e-17
Family Universal stress protein-like 0.0036
Further Details:      
 
Weak hits

Sequence:  AMSG_12138T0
Domain Number - Region: 387-467
Classification Level Classification E-value
Superfamily RNI-like 0.00235
Family 28-residue LRR 0.022
Further Details:      
 
Domain Number - Region: 586-668,702-759
Classification Level Classification E-value
Superfamily PIN domain-like 0.00569
Family PIN domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_12138T0
Sequence length 926
Comment | AMSG_12138 | Thecamonas trahens ATCC 50062 hypothetical protein (927 aa)
Sequence
MTLRGLVRPGDEVVVVSAVPGSADSLAMPSALVGETELSALARFVANEEAKARELVTEVA
AGMSQLHSGEVRARAEMLLGVPKDELIKRASAEDVDVVVVGSRGHGTIKRTLLGSMSTAL
LHQCHKSILVVREPPAADEHLHARRWLVGLDDSTAALAALEGVTAIAGKQEHIFLVSAFQ
PFFGLHDDLDAWLGNEETRNVYVTEAVLALEAKHQERLVKAGLQCSASFRIGDPRKVLVE
EAKANKVDILVVGTRSMGAMARLVLGSTATHIIHSAETPAIFVIRYAHEEDEEAVSHAVL
SARAAELCAGSEFVIMVTSRSANSYGVQLEIRASHGLGLGPGHGDDGHDHVPSDDEDGST
MVALVKSVVAMGMAVNEAMAEAGSDLRLPTVFMLADNALTWPALQLLFTALADPLVASSL
DVIILKAFRNALAGPPPAVFSAVLTLHSLRELHFSHNELDTSAAKALAFMAADAQEAKAA
AVPLWLRIEFNVAKAKALVKALDNAHVSHCIVSQMDRHARRCSPKRCAASPTPLLHLPYL
YAQRTALPHHRAQLVDASASASASAPTHAANVAIGSAADGAGGQLLLVLDTNALILLTQR
GLFSALVEALFDACDESDGTESNDTPFSFAFVVCDAVMGELDAVKSYSGSPSKVRSAIAR
FVKDDLTRSAEAGLVVYPSRAAFEGAYKLAGDEWHTAYLPDNPASLTTDNLLVDTVRYHA
VLAAPEDHNYVLVTEDGGMLVTAQRMGLPVVRTSSLVETLTAPDAQPWTELDLRTNLISA
VPGLGECLSSFDELHASAAASGFSSNPTSELAAAADLVDNLCELLADAPDDTLSAARARA
AHWRKLVERKSMWMALGSSTPAKLGRFASPSPSSPFGSPSQRQYRGRGRGRGRGRGRGRG
RGRGRRSSGKRGRGGRGGRGRGRGRG
Download sequence
Identical sequences A0A0L0DI53
AMSG_12138T0 XP_013755623.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]