SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_12238T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_12238T0
Domain Number 1 Region: 502-624
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000055
Family Second domain of FERM 0.004
Further Details:      
 
Weak hits

Sequence:  AMSG_12238T0
Domain Number - Region: 2179-2275
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000502
Family VBS domain 0.035
Further Details:      
 
Domain Number - Region: 1471-1582
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00377
Family VBS domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_12238T0
Sequence length 3074
Comment | AMSG_12238 | Thecamonas trahens ATCC 50062 hypothetical protein (3075 aa)
Sequence
MGASASRLTKAAGEVAAVAESRAGEARAAARAAESAARAAKDAAAIAAQNAAGKDAEDDL
DRPSREATDDAALLANMAALEVEAYVDTSVNAHRHTPEAVAKRQAEAAKGGRPLPQSRQA
SPSPGELWGGVRGNAVTPGFLNENQLRALLSEDLAAADIDALATSYRLNADSLAAVIKHH
ALYEPIPDEDGTLRGYWVVPPLSPKQQLLLDEDALTNIMAPQARAVDDGDVVMVVRTAGG
VGRAVRSSQVLTSSSLAHDSGDAAAAQRKEAARNEENGDVMLDDAVVTGPALPKPRSTLG
RHVTESLMTLTIEVFDRHPVTGVEALFISRKLQEVDPLWTVNQLADVINESILHSDPTKT
PEQGWADDGLGRAENVAKHLDIDFVAKYLQGPRTLKFYSIKTRSRLHYKMRRRAVKFHIF
GSLRTVLIDESWRVYRIVKEIGSVLGLRAPDEYSLKVEDDPHHPEKHWLRGAQTLPEQRI
PLDVTWDSAGEEVPPPVLHFKKKLFFKHTPNFDPTNPEAMFIYYQQCTAMVLSCELYTSR
TEAVLFAALQLLIRDSGYNPQLHDLPGFVKRWSDCCPAHVIPSKAKAKSRLEDAVRSTMH
RFKAYSREQLIVKYVKLCRASKFFGWANWPIKEQVRSGRKYRFVARVLSISGKGVRLLDP
AKHNDVVVSHPWTEVVAVGGITINRGFGLMFDFSRGNALRIQVQMEDQTALTEASQYVAD
YMRMMVLLERNKKKRLAQARDDVWGPLAVGFQMPPAHQRSGRIPACSAGAKSVVASMQLA
MLDDEAPASAGGAIVPDIPKQNVPIVDHETDETAAVGAVSTVASTLNKSAAASRDLHTTV
IMDDDDIATKTTHDKSWDVIALDSDDDNEISKLLAQADAQDNVAVLSASLAVSTNELLHA
SALDDPLMIDPSALLAAAQGLADMLASLTEATATAAGVAASPETAHALAEAHKSVQSSTA
GLVAAATDVAAAAVDHHAKLATCKSDDPKEDLMALYEITDSDSGSDSDSNDSEDGTQEGN
ATAAGASDGLRSREAKLKAATAIDISSLMAAASQVGSSVSGLLATSGVATSTERQVERLG
RMAEAVTEAALDLTDACINFFPDELPLTEAAILERRLCSLGRLVPDVHNSLLVKGAQLLE
MMRIATGAIPAHYAAKFELGLTAYEAMATLYTTLEHINDRPDFHDDYARVLQELRYHLNL
LKDRTVAQDATRLDMYVTYIGELATELGTIIETEAEACDVNGSWAALEAEAGDFARAVLA
LQDIAASVGENPDTSGIARLKTETCDVLDALDSIHVSRAHLFVIEDVLDASALVLGHMRS
VLDAATDLPLLASDDGERMLFEANRAIDRLSTTMRIYSVNPSNVRHQDIAMQAARKAVRK
FGALLDGILVPLGAAIAEGSKLSASDDGALLAAEVAHGSLAQLKEALSVAAIDCWPLDVN
SAIQVIHNEIQAINAALDKVADPSVGLNPAPGDHHSEFEWQAELLRSVRSIPKEVTDIRD
TAMTLTPAEFALDCKDVAAEVTILAEASIGMASYSTTRQAQYSLLTAARAFCTDAIELIE
CAQTVVREGNDPYGSETAVAAALALVLSALDELMLCIPGIGDTRRLVRKLEGEATEVSSQ
IRLASQPKVAQFGDLASAASDLASALAALADIPAAAPSPLTGLQASTSSSGRRGSIMATS
GLAALAGESSTSVQKADTSPLAMMEQEVSAAGRTLAALVSSLDRAALASPSALAHAVSRV
SAMADVIYRAAAASVATPELADSAQSINAPLLSLLQSTLVALRDAADIAVDPTDDEARAR
FRQNDVAGSIATLHMTYKELAAPNPEAQSKELDKARTMIDGALAKLASYKDDCSGGNELA
SVDDSEQDVPVAQAALELQDRVLASTAELQTASQALANVAEVSPDDYASAVSRVGLLTTK
TINCVLATAQHLKSSVAAKAAASAAKHAVIFGAKVVEKDVALVAQALSGLSGVDPHKGAL
LTRETQHLTAATHDLLIHNKRVLRKLPLQDKAKRQRVQRWGASLKAAERAVRRASKVLRL
SPDSDRANEALNVRVAEFSAALADYVEYMGVLELAEYDHAAAVVANIKDALIDETIEVAN
LQTSLLVTSQLVVANPTHAAAHRNMTAALGESVRALQSLHETAALVSPGQKECVFAIDHV
EKCAQHMQRFLAQFARDALPPSTTSNYGKCLDRLLAHLNVLEAAASELATQATSSAEGLG
AAALHFAELADPLRVLSLDAAVTCGSAELGLRILREARDIPLQAVPFVKACQTCRGGAVP
ADVADEATPAALLHLFQVEIHELREVLEADRAERHSLATLRALVEASNAKLAAAATTRHD
GERPRGPRLTYGKYVARIKAAFADFLVVIKKLVTMANAHAKRDAVLEDEELAVFGVHAAA
LGKVFPPIVDEVAGCIAVTSDKKLQDVLAQAGADVGTQLLAFVDELMALQARDVEASAVV
SASSGVSIALARLLQTVGRGETPKRVFESACSEMAAATSSLRTATYILNAVDQDEVGEAE
SLESGDRGGADEQPATFGECMVEVAARLRESRGQVATALAANKIDDESAAVVAREVARRH
EATMATLSFSLLLLTSVAERNRVAEVGTDAAKALEMALQLLGSKNHAAGASKALAAVDKA
LGAVEKAADECGHAEAQARDEVVAMAAEVAAIRSDAVKLASGYASGSSQVYLVQVVDALK
FGRHLVQKLLYESEALVCKPLKLVGEVRRVVRNYAETVTTLGEAQCWLASDEHATAVADA
LTVLGGAVEGVVGKVFDGDEVRSRMATAHATSATLAMRALTTTQYGPVRLAADEAIAAAA
AVSKRASMAGGESGLAGGDSDAVFAAELQALVDEMEKGKVVLAKIHLAGDGGTEVDVERE
NFKSIALRCCGEMADACVTLARVVVIALEETMPSDEEREELLIALYAVSAAVTQMTTAMV
LFSEGAPAKALSRAVSVVSEAVMSLVADALRERTQSAAAGSVRKAASMVGSACATLLQAV
EVYTTPASKMVREDVSNASGGASGGLALAGATSAEAANVSEMIRRKAEIERLQRDIQTLK
ENKVRRRAAAAGAR
Download sequence
Identical sequences A0A0L0DLQ1
XP_013754916.1.50528 AMSG_12238T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]