SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_12254T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_12254T0
Domain Number 1 Region: 458-681
Classification Level Classification E-value
Superfamily RNI-like 2.35e-22
Family 28-residue LRR 0.018
Further Details:      
 
Domain Number 2 Region: 639-884
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000445
Family Cyclin A/CDK2-associated p19, Skp2 0.059
Further Details:      
 
Domain Number 3 Region: 287-349
Classification Level Classification E-value
Superfamily F-box domain 0.0000000105
Family F-box domain 0.0081
Further Details:      
 
Domain Number 4 Region: 339-497
Classification Level Classification E-value
Superfamily RNI-like 0.0000000353
Family Cyclin A/CDK2-associated p19, Skp2 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_12254T0
Sequence length 917
Comment | AMSG_12254 | Thecamonas trahens ATCC 50062 hypothetical protein (918 aa)
Sequence
MRSNNAESSGAPSAGGRASGSGVGRTSSGEKGGARAESEAGGTSTEATEGTRQASTVGKL
RDVVAVLVLEWLTDAGLHKTRQMLETEGMALIRAGSNVEVPRVTLEALLESYTASARRAT
SHAAVLDKMATLLRHLGSQPGTDKASEAFETIAALVPPSTPLDFITPSHDLFFSEAMYHS
DDEGIDRRAKRHRPMGFLDTITATANGDLNLDDCTDSIMPLLPPSPPYPIAAGHFDVVPP
PPPPHPTARTGDSNGASVTASLERSSPPRSPAKRKRRPIHNPFPVAELLCTILSFLDVWD
LAAASATCTALHTAATDPYLLATLVHTVRPPPALPPQRLMDFLAARSSLRRLDLSERTVS
FALLGSLPAACPRLEALTLDSCLGFAAFYDGPPDPSVPKLGIVQVVQALNGSLRSISLRN
TRGLNCELGLLLAAGGGNLVQVAVTGSVSTKFSSFDPNHAASLRVLDLAACRGLSNDGLA
ALLAAATGLISLCVARTAVTGAGFAAASLPRLTNLVIAGCMCMGDECMLAVLSGAPALRI
LDASFLPITNDGVAAIAAHAPNLTSLTLRKCSHLGPGALAPLALAGTRLRVLNVAMVSEL
SHEDVVGVIGGSGALSRLVIAGRLTGANWSSLLTTPHLDRLRSVSLSGLAHLADEVVGTL
LASVRLARIAVVDCGGFTGIGFEDLKLGFGAAASLTHVAAYNRALLPLEHNVGMVSAIGR
NCVNLVGLRIDAKNLTRLALLRWRTSHLRELHIAGCEETIDDVSWILPSVFPAYVSKPTK
LALPWLSLRSSDLVEVLASQPARFLHSLDLHGTHIDNDILPLVFTALPLLTDLDISNCLD
LDDNALNGVDASRPNRITTLNLSGARGLGVRALRRIATVSPNVTSLNSADLPGAASLVIS
SLFPLLQVTGVGQWLHT
Download sequence
Identical sequences A0A0L0DLG5
AMSG_12254T0 XP_013754802.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]