SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_12265T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_12265T0
Domain Number 1 Region: 413-812
Classification Level Classification E-value
Superfamily RNI-like 7.16e-37
Family 28-residue LRR 0.0038
Further Details:      
 
Weak hits

Sequence:  AMSG_12265T0
Domain Number - Region: 54-147
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0392
Family Calcium ATPase, transmembrane domain M 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_12265T0
Sequence length 1016
Comment | AMSG_12265 | Thecamonas trahens ATCC 50062 hypothetical protein (1017 aa)
Sequence
MVLAIVCMATLAWVVDEAGNTTLYIGLKKYRRETPSGDISGSLEELKQTYPLARKLEEGG
DNILGTGIVAIILLFAALIMIIIHITGRPQYRLHWIAIILLFFAGFLAMLGTVLYAKKLN
VGYSFILFTFTGPLIFASAVFMLYAIVSSRGPAYVPRKAPQQAPATGSVYNEEFTQVKAF
FELTEENMTFCGWVTKTKRKKKSVDHRLLTIGQYRVATWKESKLGSALKLAREGHLLDLA
SLDYVEAAEHASVNLKFREFEFPFVETLSRGRHIVSLIKNFYVLMSCNVPQETFFGLYVN
AAPDAPEDLSRFPPLPKGIPFSGFVEAYEAHCVRAGLQLANVVVYRELLDYIVQHAGDRS
IALVPSLLNSFEFLDAKARPLFLLEPFVNALKYNAYFESVTVSSVTRLDIFDVLSHAFTA
NSTITRLDLSELSANSGFGVFGRALRDNPVCALTAIDLSFNAIKDKGIAALAPGLATLQL
RELNLAYCQFGAKGMSALGKALAAAPHVATSLAQLDLSGNKLGSSGTSALANWLVDAPIT
TLASLNVAETALKVKKFSPILSPEATPGLVKLNLSNNTFVDRDVVHLSNALMSSAVVELD
LSAAKVSIESLAGIVGCLVTDRTRTRSVLDLSSIPLKPAGAIRLASSISVGLNLRSLCLD
DAQLGSEGTIAVLEALIQSPMIEALSLSRNVRAKDKALPDVVNALVRLVSLPNSPLVSLE
ILGNSKYAFGSSLVEFFDALASNAALKELNVEGNGFRDEGAEALGAALASNASLETIFID
NNAMSLAGLDAFANGVASNSSIINLPIPDAEFKRIVLDNAGDTEAFEKMRNIIKTLRFAV
RFNKTGRGAGWAAPTSLFGDDPNLSDDEWLARDKLERRARRAARRAAKAEAERRTNEVGS
AHRASLNMSRANKRGTLSISDFQVEDFMERMGSVSKAGGGAGAAKGRGLLATAARNRATN
QGSDAVVRIRPIPAPRPTSMVGAGAGPSETTFRLDYSYDSDSDSGSDSGSGSNDSS
Download sequence
Identical sequences A0A0L0DND1
XP_013754378.1.50528 AMSG_12265T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]