SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_12267T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_12267T0
Domain Number 1 Region: 8-242
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.15e-53
Family Nitrogenase iron protein-like 0.0054
Further Details:      
 
Domain Number 2 Region: 551-686
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.78e-30
Family Poly(A) polymerase, PAP, N-terminal domain 0.045
Further Details:      
 
Domain Number 3 Region: 689-832
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 3.66e-24
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_12267T0
Sequence length 1002
Comment | AMSG_12267 | Thecamonas trahens ATCC 50062 hypothetical protein (1003 aa)
Sequence
MAAAQRTVAESMAGVRHTVMVVSGKGGVGKSTVAAQLAVGLVARGFKVGLLDLDLCGPSM
AQMFGLDDASAHQATAGWVPVFPPGHTQLCVMSIAFLLASRDDPVVWRGPRKSAMVTQFL
RDVVWGELDYLIIDTPPGTSDEHLAAVKALSNLAIDGAVVVTTPQMVALADVRREITFCE
TTKIPVLGLVENMSGFVCPCCNEVTYVYGKDGGKALAGMRKIPFLGSIPIDPRLGLSAEA
GAVLGAAESTTEPAVELAAGEDASAGAQDTESVPFASSPAALAIASVVDAVPARAKAAEA
DKRPPATDEQPGESPPAAATEPAAAAATEVAATTAATSAAGADPGEAAGRRPASPLAESP
PGEELPPPPQELAHGDKRSRGLQMGKAPRSRQSDTGSVSGSSGSSTATGSSSESSSSGSS
SGSSGSSSSSGSSSSSSSACSSSGTGTTTETGTGTASTGSVSRAARRLNTSLGELGGGGA
GAQCSPRGRDTASPPPPPFAAARPFHSLAELKARVQPPPDMAEPPVWMEATSRRILPYRR
RAYYPYSSTASAMQSLDEEMKDFVRHVSPSPPERAMREAHVAKIRKYVNELWPKATTVVF
GSFSTDLFLPDSDIDIVVYGVRHPDKLNMLAKRLYAAGFCSYCQVIPTAKIPVIKIAEMH
TYCRIDLCFDVRGGPENAAIIRSYMAAYPQLRPLTVTLKYFLFERQLNVPFWGGLSSHAL
VLLIIHMLKYYPLDEEFESVEDGELGARLLQFFKLYGCEFNTVRDVVSIRPKAGVLSLDL
PKKADFGWFDVFRAHDIAIEDPHASSNVTANCTNFPVIQHEFKKAYHTLLRCSSSGRSLG
NAPSLLSSIIDPNAYYAAHSHRMAVAAALAAACTPQQQNHYHGGPQAGLVLAPPPVGQPA
VLRAGPSSPASAQHREPGLMPDLDSDAHSESASGDDAHDGLISASPSQADLDRVDQMRAE
FDSMHVGVTSADAPKAQAQAAGTPTGWGGKKSFAEVVAGSIE
Download sequence
Identical sequences A0A0L0DP37
XP_013754380.1.50528 AMSG_12267T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]