SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_12290T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_12290T0
Domain Number 1 Region: 478-667
Classification Level Classification E-value
Superfamily RNI-like 1.92e-34
Family Cyclin A/CDK2-associated p19, Skp2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_12290T0
Sequence length 1056
Comment | AMSG_12290 | Thecamonas trahens ATCC 50062 hypothetical protein (1057 aa)
Sequence
MATGVDVLAAFNIAKDAFSVASLTLPYIFLSTGLPLAAASVLVLGLASWAGAVFLHRAAE
DAQTKISGSSASSASLLAADRLVDAPPVSYSHCVELLWGRRAKMAADVTIVVVDTSASFA
MLIAAGQALHSVGAIAASHAFLAHYPPLVIAVGLVVAAVCVALPSGDALKYPSALGATAF
LALLVLTGVLGARGELHQADLPPPPPRSHVWSSLGWPNSLRAAVLAPGVLKFCFAGIESW
PSLAVPLGQAYIPTLALATAIMMSFTMAMGLVGYAYAPADVAENLLLDLPDSVAGNSARI
ATAAMLAFTTPILLFAAFEILEFATAAAFPSLAARPSPAGPPASLTASPSDPLLPSINTV
LSQSPQSPQSPPTASRPAATAIRLLLVIIASVAAASFPNLVYAVSVTGAVGDSALGLVIP
GIAACGHRSPIAGIALVIIGLVCMICAAHFSGDRAAFKTSIERAGAASVTRLTVAPSSSD
GEVEYAASLVSSIVELDLARCSYVTDASISAVAASCPALTSVNLYCCERVGDEGVAALSH
GCPQLATINLRGCPSITAAALAALADGRGRMLRELNVHGCHLAVTDDALAHIAASCPSLC
KLDISGCKYVTDVALRALAAGCSQLTSVVAARCRELTDTGAIAVAAGSPNLRTLDLAGCR
KTGSVRSATSARRAYLEWMANTPPTEWDSLYVGHANAALCNLAALGGLTPATVRAALAEG
IALPPELPQVIADSMPHASALAATVHDLLGAAASRPESQPPAYSLDPPDVADVPDDEIEP
DESPFGASSPPAYVSPPQPAPPLLPSNSGSTPTAARICAAPSCGAGVELGRTCSAVCRAR
YAAAKCALCAALITPAEGYVLGCSAPCDAEAFFLAASPPSTATLRPIATTSPLGAFVLST
IVASWSRTSSFDRSRLRSLHLVLPSTAQAAAFASARSRHAALRWAFYPLRAVCTPSAPAV
LPCGTAECSLCNTAVAGFAPDYTGDISLTTVASHAAFSAASSSSSAPASSATASPSSLWF
ALAAVAGGHSAADTVSVTATDAARPVVFVELAITSW
Download sequence
Identical sequences A0A0L0DNF7
XP_013754283.1.50528 AMSG_12290T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]