SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_12336T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_12336T0
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily RNI-like 1.35e-33
Family 28-residue LRR 0.078
Further Details:      
 
Domain Number 2 Region: 177-344,381-467
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000392
Family Ankyrin repeat 0.0033
Further Details:      
 
Weak hits

Sequence:  AMSG_12336T0
Domain Number - Region: 524-586
Classification Level Classification E-value
Superfamily Tropomyosin 0.0229
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_12336T0
Sequence length 631
Comment | AMSG_12336 | Thecamonas trahens ATCC 50062 hypothetical protein (632 aa)
Sequence
MAMVVVEMCPNLTTLNLYNCSNITDAAVVTLAGGCPNLTTLYLDYCSNITDAAVVALAGG
CPNLTTLGLRNCSDITDAAVVALAGGCPNLTTLYLNNCSNITDAAVVALAGGCPNLTTLD
LNNCSKVTLDLHRARTAIAQPDFPASQHAHALLDVAQAHVPHPVHAIDRCNLLSLSALNT
LLANGADLYDLDDDNTHVYVAAPASAPVFVDLMIESLQANADGATELANGINKATLALFV
VLRASPTVPISADIVSELITAGADVNAVEPTFNTPVIHVAFAHSNHGALKALLEAVAALD
VVLDQSAVDGNGATVLDTIIAANQLTAERMAELGGVGLDPFTLQPDNTHVYVAAPVERSA
VFSSAMVAWIREHGDGATELTSGINKATLALFIVLHAADTIPFSIPVFAFLINSGADINA
LEPSLELRPLHVTVSPSNILATMALLAAGADVWALGTKGETAMSIASAVLNKPGSDTNAA
AKEVYNLIVGTSSIPERVADHVRETIAAGGDIGGGAGASAGTSTRVDKLEAELADTKAKL
ADTKAELADTRTELADTKADFADTKAELADTKAELADVRDHVTIATGNIAALQADRANIL
QHVDKAIAIFQARRYAHTAAGTSSAGDAMPQ
Download sequence
Identical sequences A0A0L0DRT9
AMSG_12336T0 XP_013753459.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]