SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_12336T1 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_12336T1
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily RNI-like 1.33e-33
Family 28-residue LRR 0.078
Further Details:      
 
Domain Number 2 Region: 177-344,381-467
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000036
Family Ankyrin repeat 0.0033
Further Details:      
 
Weak hits

Sequence:  AMSG_12336T1
Domain Number - Region: 524-571
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0275
Family PspA lactotransferrin-binding region 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_12336T1
Sequence length 624
Comment | AMSG_12336 | Thecamonas trahens ATCC 50062 hypothetical protein (625 aa)
Sequence
MAMVVVEMCPNLTTLNLYNCSNITDAAVVTLAGGCPNLTTLYLDYCSNITDAAVVALAGG
CPNLTTLGLRNCSDITDAAVVALAGGCPNLTTLYLNNCSNITDAAVVALAGGCPNLTTLD
LNNCSKVTLDLHRARTAIAQPDFPASQHAHALLDVAQAHVPHPVHAIDRCNLLSLSALNT
LLANGADLYDLDDDNTHVYVAAPASAPVFVDLMIESLQANADGATELANGINKATLALFV
VLRASPTVPISADIVSELITAGADVNAVEPTFNTPVIHVAFAHSNHGALKALLEAVAALD
VVLDQSAVDGNGATVLDTIIAANQLTAERMAELGGVGLDPFTLQPDNTHVYVAAPVERSA
VFSSAMVAWIREHGDGATELTSGINKATLALFIVLHAADTIPFSIPVFAFLINSGADINA
LEPSLELRPLHVTVSPSNILATMALLAAGADVWALGTKGETAMSIASAVLNKPGSDTNAA
AKEVYNLIVGTSSIPERVADHVRETIAAGGDIGGGAGASAGTSTRVDKLEAELADTKAEL
ADTRTELADTKADFADTKAELADTKAELADVRDHVTIATGNIAALQADRANILQHVDKAI
AIFQARRYAHTAAGTSSAGDAMPQ
Download sequence
Identical sequences A0A0L0DRQ0
AMSG_12336T1 XP_013753460.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]