SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_12426T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_12426T0
Domain Number 1 Region: 7-180
Classification Level Classification E-value
Superfamily RNI-like 6.28e-47
Family Cyclin A/CDK2-associated p19, Skp2 0.012
Further Details:      
 
Domain Number 2 Region: 458-550,587-673
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000354
Family Ankyrin repeat 0.0031
Further Details:      
 
Domain Number 3 Region: 227-377,455-523
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000163
Family Ankyrin repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_12426T0
Sequence length 823
Comment | AMSG_12426 | Thecamonas trahens ATCC 50062 hypothetical protein (824 aa)
Sequence
MAMVVVEMCPNLTSLGLNGCSNITDAAVVALAGGCPNLTTLNLYNCSNITDAAVVALAGG
CPNLTFLGLENCSNITDAAVVALAGGCPNLTTLNLSSCSNITDAAVVAVADGCPKLTSLI
LRSCTKLTDAAVVAVAGGCPNLTTLSLYNCSNITDAAVVALAGGCPNLTTLNLNNCSKVT
LDLRRARTTIAQPDFPASQHARALLGFAQAHVPHPVHLMARCNALSVDALNTLLANGADL
YDLDDDNKHVYVHSPASSAPVFVGLMIESLRANADGATKLANGINKATVALFVTLRASPT
VPISADIVSELITAGADVNAVEPTFNTPVIHVAAANTEHGALKALLEAVAALDVVLDQSA
VDGNSATVLDTIIAANQLTAERMAELGGVGLDPFMLQPDNTHVYVAAPVERSAAFSSAMV
AWIREHGDGATELANGINKATVALFVVLRASPTVPISADIVSELITAGADVNAVEPTFNT
PVIHVAAANTEHGALKALLEAVAALDVVLDQSAVDGNGATVLDTIIAANQLTAERMAELG
GVGLDPFTLQPDNTHVYVAAPVERSAVFSSAMVAWIREHGDGATELTSGINKATLALVIV
LHAADTIPFSIPVFAFLINSGAGINALEPSLGLRPLHVAVSLSNIPATMALLAAGADLWA
LGANGETAFSIASAVLNKPGSDTNAAAKEVYNLIVGTSSIPERVADHVRETIAAGGDIGG
GAGASAGTSTRVDKLEAKLADTKAELADTKADFADTKAELADTKAELADVRDHVTIATGN
IAALQADRANILQHVDKAIAIFQARRYAHTAAGTSSAGDAMPQ
Download sequence
Identical sequences A0A0L0DTZ5
XP_013752840.1.50528 AMSG_12426T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]