SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_12427T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_12427T0
Domain Number 1 Region: 274-299,352-601
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.69e-17
Family Ankyrin repeat 0.0023
Further Details:      
 
Domain Number 2 Region: 1941-2057,2134-2327
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000126
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 
Domain Number 3 Region: 1628-1760,1808-1884
Classification Level Classification E-value
Superfamily RNI-like 0.00000000209
Family 28-residue LRR 0.038
Further Details:      
 
Weak hits

Sequence:  AMSG_12427T0
Domain Number - Region: 211-292
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0199
Family Ankyrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_12427T0
Sequence length 2344
Comment | AMSG_12427 | Thecamonas trahens ATCC 50062 hypothetical protein (2345 aa)
Sequence
MLTGLSREILQLIAYATNRLTAGEVLSLALTCRYLYTALLGSPFTRSLHHALGGLEHCIR
SQAWAGGRRIIASSASSPLPADLIHMVFATGDEECHQWMALVRDMATRRMVFHPSWGLSS
SGTPAMPSYSVRLAFLRRVFGARFLPLPLAALAALYGHQATALELAQPTDKPLSPLALLA
VAACAVKANTIELMAALAPLVDLAGRSELLLRLAIDLGRQEMVRLLVDDAKVKRAVLPSS
LLVRAMRSPHPHIAIMLLDHPLLDPSSDMADLLTKACSFGRADVVHRLLAQPSAVLDVPL
LHRLLRAVTDSASTASLAAVLAAATAAGIAPDPSDVDNVIAIAMTGRHTDLVLLLLSVDG
VDGNAALCRAAAAGLDDVVRSLLADPSVHPGHDQQRALCAAASGGHDAVVKLLLADPRVD
PASNTSAALRHAASAGRTSVVALLLAAPGIDPFADNLHALRSARLHGYMDVVELLLAHPA
ADPALDDNYPIRLAAALGRTARLGELLATPGVDPTAADNEALCKATEAGHASAVALLLAD
GRADPAARDNLPLRKAAAHGYAAIVANLLASGRVDPAADGNYAIRMAASRGHLAVVDLLL
AQPGGSAHGLPTTPLLASSLPSGMTVLADRSVTTTESPVRRSSSLTCSTLRTSSETLDEI
EDADPTDGDASDSELDSDPLHVASIFLSAVTKRFAGAFPAAAAAEPAVDAAPAAAITSMA
TSLAGWTCAAKAAKLAVAERTAANVAAAAAAMPDDLPTSPSSPSSPSSPTQLGSPPLAAS
FAIASLAQSSSSSLATSESTELLGGSSSDDDADDDDDDDDDGGNDGDGDDKGDGGWVDLG
SSSLLCSVSPYTAALCADARWMCTLAALDAAAKPLAASGIAHAVAVCGPARINALCRVLV
VTPQPEALTAAAAASALLAAFPRTRIASPATAAAAAAPHMYALVAGDATIFHEYATQRRQ
RAELPHPLAGLPQARIRHADALAALAALGDAPPDDLVEAITTVVAALAAFFNVSPRLVTG
QRRRPGAPPTELLLAALVAAQVVNSYVASQLVAALHALVGSSALAAEAAPVAAPTIATPL
AHMAADMAGGMARCGAAAAPRALDTSNAALLAALPFRDAGYLAAAAWRVSLDGISSPVCT
YGMAGTRGPPRRYAGLGIGMGAPVRGACHLGAAIREIDGEAWPEFLASRDAFCARYPAYR
AVFYSATTDEVRMLAPQAVGQLFGSAVLAGNARVRVGAFDFLLADATAPHEVAVSVLARA
LFHGGASGRSPHPGGVPAADLVKVFYLNKIHVFLVTHAVHGPLLADALRAAPPTSAAPLA
LDPYSFSLHTVLALITSPEDACPRGYVAEHLPPLPAAVIAPGDVSLAASPLGLVRTGRGR
AFVEPTAKGGRLSARLALLKNVLFCMRAGMRAKVDSALAAQLAHAPDGRTIVDLTLDVLR
GMELRMSEAPAMLKAGLVHLLVARIDDVVGTVCADPAMTHTELLATAQPQLATIYAKAAK
TPCPVKAFITGILRKQWRCGRRLSPDEILDAQMCLPTSVVSGGRARSWSRTRSRTRSSSA
AGHKGLGLGRKRSKSGAIVTALSEDGGTAGEQGDLEALVVPSQLPGAGDAPLWYDAALVG
LVTAGDAEGFAKLPHRLLMQRMLSDMDFGACAVGSSALKTILKAATPMTLRTLVLRNVAV
LTDVLLEPLLAKTPHLQELDVSGGVELVTVGRVAAHCRLSLAVLRLVGCVRIPLPELDLI
EATCTRLRAVHLGPSHSRDLYSPGATCAAHPRCLVTGAPHIVWAHLPPGMRRALAAFAVP
PPSATPRALSAFASRIRVDLASADLADALVANIAVVLPTAERISALSIADNPRLTDASLL
PLARAFAANDCIVELDVSANPGLSPLATIELDALRATLLADIGRELVLSGSCWASARALC
PAQVPSPLPPRSVLAGEVTAVAAVSPTAVIVGSAGGKLAVIDSASGSSRVVDIVLSSPVV
ALTIDAPRGKVLAATAAGRVAVLALASWRLLRILDMTAATDDAAVTDDEVSTECVTPTTP
TTPSVAWSSSAASSPAPSPKPLTPTTPSSAASASASASASASAGGRPSATFAGLHTLPVP
PPIQIGRNGSEVEGEGGSVGCDELLDALPDDGRESDAVVGAVVLPRKRAVVASAAGAMTE
FKLSSGRKVAAFEALAMPGGRLVAVAVTDEWAVAAADACGRLAWWTRAARDWVRVAEISV
GMRTATVALARACGEKVMLVSVAGELAVVDTSAQRVVARRSDVRGQAGTVRAAYPLGGGL
VAVVAAQPWTVTVWNARTGLSVVTHLAVPAHPLAPAADWHHVVVDRRSGAVVVVGGGVVQ
VMSV
Download sequence
Identical sequences A0A0L0DTZ9
AMSG_12427T0 XP_013752841.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]