SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_00869T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_00869T0
Domain Number 1 Region: 759-1140
Classification Level Classification E-value
Superfamily RNI-like 1.65e-49
Family 28-residue LRR 0.019
Further Details:      
 
Domain Number 2 Region: 28-127
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.95e-16
Family Ankyrin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 395-496
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000144
Family Second domain of FERM 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_00869T0
Sequence length 1180
Comment | AMSG_00869 | Thecamonas trahens ATCC 50062 NOD3 protein (1181 aa)
Sequence
MASSSSGSGVGRGRVCNERTVVKSFFRAVGHGNVRKVVGMIRKHGRGMVDVRDGVKDWLP
IHFACVCGKRDMAKVLIKAGSKINAAAGPTGNTPLHLALLNRHWKLARSLAKRGADWEVL
NSSGKTPRLLLLEAQEFGSGARGGTGVGGGDGSGSDVASFDSRTESSSSDGNGDGEVVDG
VGFGSLADFYRRTASGMASDDDMSSTEGEGRLRRLSLARRSSIGPRRQSSKATGGAPEVI
VARSSSSAGYVAPFPIVTPNDDPPISLRRLREELKDKVSVFAEHATVRKTDVDQDTIVVR
LKAPDDSTKKLMVNSSWTGEELENFCCARANLSRAEAELMELVVLDSGDEQSIVTYVFAP
EPIQAQGITHGTLLYLRVKYFKIPVKPSVPLLTVLKEQLLSNMMDGSMILSERLAIKLAG
LQLVISNGPFRPNTFYKGFLSDVSILRYYLPPYLIERYPPKLWEDRLLAAYSAVGDIELS
KALQVYVETSQQSPNYGATMFKGRAKTNGMYAQLGVAQDGVYIDVRGAAPKFYGFYRSSG
KTQHLPNLVGWQGAVGGGGRVVLHLREGVAGASVQQVEFDITGGACVAVEFLDLLSGYYI
LLVYSDALYDHPILVLDESMWLLPREPLPLRIACQPAATRAPNIPYSDLDWFVEHYHAQC
VNQSSPPLVSIFHRLHSAMDEGRPWTSLDVTDARSSTSQLRVLNFAIKSLGALERDAFMV
PGQMRLTRVSFADSRIGARKDRLGAAVEIMATLGLTFAIATVDVSRCELQSAEQYSRLAA
GLSFIVPLNKLVLDGNELCGKEAVSELKSGLHAGKQELQHVSFVDCKMDDEAIIGFGGRL
YDEESTITYLDISHNRITDFGFEHGLMVNIRHGTSLASLNIGYNDMSSSSTAMLVEKLHE
GITMYVLGLGEFNLKSKHMAGIVERLGAVGVLDISHNSVGKGFRELAEELATNATLRVLQ
AEHASIESGGVELLSMSLAVNRHLRELALGSNALSSKMALKLMEGVARSRMLTELDLSNN
SLGKKFGAGLAAALGTGSCVLEKLVLKNNSLGASGIQGVASAIVSLPQLTSLDVSDTSAE
DAGLLALGRALVGNTHVASLSVAGNYVSEEALWEFVLLMQDNVGLRVINATRNALFEPKA
FETQLAKFKVLVDIDVSFTDGTASAVTHRLASWGHRLKFM
Download sequence
Identical sequences A0A0L0DIV8
XP_013762049.1.50528 AMSG_00869T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]