SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_01764T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_01764T0
Domain Number 1 Region: 167-505
Classification Level Classification E-value
Superfamily RNI-like 8.63e-66
Family 28-residue LRR 0.0093
Further Details:      
 
Domain Number 2 Region: 50-223
Classification Level Classification E-value
Superfamily L domain-like 1.67e-34
Family Internalin LRR domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_01764T0
Sequence length 535
Comment | AMSG_01764 | Thecamonas trahens ATCC 50062 hypothetical protein (536 aa)
Sequence
MKMTMGVLLGVLVMAMVVVNVVAGHPSYMGATPRCQEIMTRMRGADWPSEVLDLKDCYLK
YLPAEVGLLTHLTKLDLTGNDLDELPFNFGNLVNLRELSLWANEWEHVPEELKGLKSLEV
LDLSYMKLKVLPEWLATEFPKLKRFSAHGNGITKMPDSFASLQLEYLNLYNNSLHELPSW
ICEMTSLKELHISHNEIATIPDCIDNLVDLEVLGLWDNDIHTIPESVGNLRNVRLVSFAG
NALHSLPDNLYNHWTHIDDLDLSNNEFSSIPAVVLSMSHIKELHLHGNYLTSDKLPADLR
SLPNLEYLSLGHNRLNSLPPNFLAGLSKLRRLDLSHNSFTEFPAAVAAVAPQLELFNIHV
NDIKSIPDNVLSSMTSMQKLDLRETGLTSLPTSLGTLTQLEVLDIGNNKIGPRLPNFLAS
LVNLRKLAIWSCGLTELPSWIGNLRNLEEIDFSSNDITSFPKSFELCSKLKVLHMHYNQV
SHFPEYLGTFSDLEVIDIYDNPIQHLPTGFCDGSHPVSERMAYWCFALAGGHDEL
Download sequence
Identical sequences A0A0L0DT17
XP_013761279.1.50528 AMSG_01764T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]